KEGG   Streptococcus pneumoniae SPN994038 (serotype 3): SPN994038_10400Help
Entry
SPN994038_10400   CDS       T02630                                 

Gene name
mutX
Definition
(GenBank) mutator MutX protein (7,8-dihydro-8-oxoguanine-triphosphatase)
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
spnm  Streptococcus pneumoniae SPN994038 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spnm03400]
    SPN994038_10400 (mutX)
Enzymes [BR:spnm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     SPN994038_10400 (mutX)
DNA repair and recombination proteins [BR:spnm03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SPN994038_10400 (mutX)
 Prokaryotic Type
    SPN994038_10400 (mutX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: CCP30776
LinkDB All DBs
Position
complement(1064717..1065181)
Genome map
AA seq 154 aa AA seqDB search
MPQLATICYIDNGKELLMLHRNKKPNDVHEGKWIGVGGKLERGETPQECAAREILEETGL
KAKPVLKGVITFPEFTADLDWYTYVFKVTEFEGDLIDCNEGTLEWVPYDEVLSKPTWEGD
HTFVEWLLEDKPFFSAKFVYDGDKLLDTQVDFYE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagttagcgacgatttgctacattgataatgggaaagaactgctcatgctccat
cgtaataagaaacccaatgatgtccatgaagggaaatggattggtgtgggtggtaagcta
gagagaggagagacgccccaggaatgcgcggcgcgtgaaatccttgaagaaacagggctc
aaagccaagccagttctaaaaggtgtcatcacttttcctgaatttacagcagatttagac
tggtacacctatgtttttaaggtgacggagtttgagggcgacttgattgactgcaatgag
gggacgctagaatgggttccctatgacgaggttttgagcaagccgacttgggaaggtgac
cacacctttgttgagtggcttttagaggataaacccttcttttcagccaagtttgtttat
gatggggataaattgttggatacccaagttgatttctatgaataa

DBGET integrated database retrieval system