KEGG   Streptococcus pneumoniae A026 (serotype 19F): T308_05170Help
Entry
T308_05170        CDS       T02890                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spnn  Streptococcus pneumoniae A026 (serotype 19F)
Pathway
spnn00620  Pyruvate metabolism
spnn00680  Methane metabolism
spnn01100  Metabolic pathways
spnn01120  Microbial metabolism in diverse environments
spnn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spnn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    T308_05170
  09102 Energy metabolism
   00680 Methane metabolism
    T308_05170
Enzymes [BR:spnn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     T308_05170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Lysine_decarbox
Motif
Other DBs
NCBI-ProteinID: AGZ47774
LinkDB All DBs
Position
1004683..1007379
Genome map
AA seq 898 aa AA seqDB search
MSLQKLENYSNKSVVQEEVLILTELLEDITKNMLAPETFEKIIQLKELSTQEDYQGLNRL
VTSLSNDEMVYISRYFSILPLLINISEDVDLAYEINHQNNIDQDYLGKLSTTIKLVAEKE
NAVEILEHLNVVPVLTAHPTQVQRKSMLDLTNHIHSLLRKYRDVKLGLINKDKWYNDLRR
YIEIIMQTDMIREKKLKVTNEITNAMEYYNSSFLKAVPHLTTEYKRLAQAHGLNLKQAKP
ITMGMWIGGDRDGNPFVTAKTLKQSALTQCEVIMNYYDKKIYQLYREFSLSTSIVNVSKQ
VREMARQSKDNSIYREKELYRRALFDIQSKIQATKTYLIEDEEVGTRYETANDFYKDLIA
IRDSLLENKGESLISGDFVELLQAVEIFGFYLASIDMRQDSSVYEACVAELLKSAGIHSR
YSELSEEEKCDLLLKELEEDPRILSATHAEKSELLAKELAIFKTARVLKDKLGDDVIRQT
IISHATSLSDMLELAILLKEVGLVDTERARVQIVPLFETIEDLDHSEETMRKYLSLSLAK
KWIDSRNNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKVTFFHGRGGTV
GRGGGPTYEAITSQPLKSIKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMITH
KKSDTNTPNRYEAIMDQVVDRSYDVYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFINKNPENIAILRDMYQNWPFF
QSLLSNVDMVLSKSNMNIAFEYAKLCEDEQVKAIYETILNEWQVTKNVILAIEGHDELLA
DNPYLKASLDYRMPYFNILNYIQLELIKRQRRGELSSDQERLIHITINGIATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcaaaaattagaaaattatagtaataaaagtgttgtgcaagaagaagtcttg
attctaacagaattactggaagatattactaaaaatatgcttgccccagagacctttgaa
aaaataatacagttgaaagaattatcaacgcaggaagattatcaaggtctaaaccgtcta
gtgactagcttatcaaatgatgaaatggtctatatttcacgctatttctctatcttacct
cttttgattaatatttcagaggatgtggatttagcttatgaaatcaatcatcaaaataat
attgatcaggactatttaggtaaattatctacaacgattaaattggtagcagaaaaggaa
aatgccgttgagatcctagaacacttgaatgttgtccctgttttgacagcccatccaaca
caagtgcaacgcaaaagtatgttggatttaacaaatcatattcatagtcttttgcgtaaa
taccgtgatgttaagttggggttgatcaataaagataaatggtacaatgatttgcgtcgt
tacatcgaaattatcatgcagacagacatgattcgtgagaaaaaattaaaagtgactaac
gaaatcacgaatgctatggaatattataacagctcctttttgaaagctgtacctcatttg
acgacggagtataagcgcttagcgcaagcgcatggtctgaatttaaaacaggctaaacca
atcaccatgggtatgtggataggtggtgaccgtgatggaaatccatttgttacagcaaag
accttgaagcagtctgcactcactcagtgtgaagtcatcatgaactactatgataaaaag
atttaccaactttatcgtgaattttctctttcaactagcattgtcaacgtcagcaagcaa
gtcagagaaatggctcgtcaatccaaggataactcgatttaccgcgaaaaagagctttac
cgtcgtgccttgtttgatattcaatcaaaaattcaggcaactaaaacctatctgattgag
gatgaagaagttgggactcgttatgaaaccgccaatgatttctacaaggatttgattgcc
attcgagattctctactagaaaataagggcgagtccttgatttcaggtgattttgtggaa
ttattgcaggcagtagagatatttggtttttacttagcatcaattgatatgcgacaagac
tctagcgtctatgaagcctgtgtggcagaactcttgaaatcagcaggaattcattctcgt
tatagcgagttgagcgaagaagaaaagtgtgaccttctcttgaaagaattagaagaagat
ccccgaattctttctgcgactcacgcagaaaaatcagaattattagcaaaagaattagct
atttttaagacggctcgtgttttgaaagataagttgggagatgatgtcatccgtcagacc
atcatttcacatgcaaccagcctttctgatatgctagaattagctattctgttaaaagaa
gtaggactggtggatacggaaagggcgcgtgttcagattgttcccctttttgaaacaatt
gaagacttggatcattcagaggaaacaatgagaaaatatctttctcttagccttgccaaa
aaatggattgactcacgaaataactaccaagaaatcatgcttggctactctgacagtaat
aaagatggcggttacttgtcatcatgttggaccctctacaaggctcaacaacaattgact
gctattggagatgaatttggcgttaaggttaccttcttccatggtcgtggtggtactgtc
ggtcgtggtggtgggccaacctatgaagccattacatctcaaccgctcaagtctatcaag
gatcgtatccgtttgacggagcagggtgaagtaattgggaataaatacggtaacaaagac
gccgcttactataaccttgaaatgctagtatctgcagctattaaccgtatgattactcat
aagaagagtgataccaataccccaaatcgttatgaagccattatggatcaagtagtggac
cgtagttacgatgtctaccgtgatttggtctttggtaatgagcatttctatgattatttc
ttcgagtcaagtccaatcaaggctatttcaagttttaatattggttctcgtccagccgct
cgtaagactattactgaaatcggtggtttgcgtgccatcccttgggtattctcatggtca
cagagtcgtgttatgttccctggatggtacggggttggttcaagcttcaaggaatttatc
aataaaaatccagagaatattgctatcttacgagatatgtaccaaaattggcctttcttc
caatcgcttctttcaaatgttgatatggttttgtcaaaatcaaatatgaatattgctttt
gaatatgctaaactttgtgaagacgagcaagttaaggccatctatgagactattttaaat
gaatggcaagttactaagaacgttatcttggctattgaaggacatgacgaactcttagct
gacaatccatatctaaaagctagtctggattaccgtatgccttactttaatattctcaac
tatattcagttagagttgattaaacgccaacgtcgtggagaattgtccagtgatcaagaa
cgattgattcatatcaccatcaacggaattgcgacaggattgcgtaattcaggttga

DBGET integrated database retrieval system