KEGG   Streptococcus pneumoniae SPN994039 (serotype 3): SPN994039_13840Help
Entry
SPN994039_13840   CDS       T02631                                 

Definition
(GenBank) putative aminotransferase
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
spno  Streptococcus pneumoniae SPN994039 (serotype 3)
Pathway
spno00550  Peptidoglycan biosynthesis
spno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPN994039_13840
Enzymes [BR:spno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     SPN994039_13840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 DJ-1_PfpI GATase GATase_5 Acetyltransf_18
Motif
Other DBs
NCBI-ProteinID: CCP35078
LinkDB All DBs
Structure
PDB: 

Position
1407338..1408120
Genome map
AA seq 260 aa AA seqDB search
MVYTSLSSKDGNYPYQLNIAHLYGNLMNTYGDNGNILMLKYVAEKLGTHVTVDIVSLHDD
FDENHYDIAFFGGGQDFEQSIIADDLPAKKESIDNYIQNDGVVLAICGGFQLLGQYYVEA
SGKRIEGLGVMGHYTLNQTNNRFIGDIKIHNEDFDETYYGFENHQGRTFLSDDQKPLGQV
VYGNGNNEEKVGEGVHYKNVFGSYFHGPILSRNANLAYRLVTTALKKKYGQDIQLPAYED
ILSQEIAEEYSDVKSKADFS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtttatacttcactttcctcaaaagatggcaattacccctatcagctcaacattgcc
cacctctacggaaatctcatgaatacctacggggacaatggaaacatcctcatgctcaag
tatgtggctgaaaaactgggaacccatgtgaccgttgacatcgtttctctccatgatgac
tttgatgaaaatcactacgacatcgcctttttcggtggtggtcaagactttgaacaaagt
atcattgcagacgacctacctgctaaaaaagagagcattgacaactacatccaaaacgac
ggtgtagttctggctatctgcggtggtttccaactattgggtcaatattatgttgaagct
tcaggaaaacgtatcgaagggctaggggtcatgggacactacacgctcaaccagaccaat
aaccgttttatcggtgacatcaagattcacaatgaagatttcgatgaaacctactatgga
tttgaaaatcaccaaggtcgtaccttcctctctgatgaccaaaaaccgctgggacaggtt
gtctatggaaatggaaacaacgaagaaaaggtcggtgaaggggttcattataagaatgtc
tttggttcctacttccacgggcctatcctctctcgtaatgccaatctggcttatcgccta
gttactactgccctcaagaagaaatatggtcaggacatccaactccctgcctatgaggac
attctcagccaagaaatcgctgaagagtacagtgacgtcaaaagcaaggctgacttttct
taa

DBGET integrated database retrieval system