KEGG   Streptococcus pneumoniae SPN994039 (serotype 3): SPN994039_15110Help
Entry
SPN994039_15110   CDS       T02631                                 

Gene name
stk1
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spno  Streptococcus pneumoniae SPN994039 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spno01001]
    SPN994039_15110 (stk1)
Enzymes [BR:spno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPN994039_15110 (stk1)
Protein kinases [BR:spno01001]
 Serine/threonine kinases: Other
  Bacterial family
   SPN994039_15110 (stk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CCP35205
LinkDB All DBs
Structure
PDB: 

Position
complement(1541284..1543263)
Genome map
AA seq 659 aa AA seqDB search
MIQIGKIFAGRYRIVKQIGRGGMADVYLAKDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EARAMADLDHPHIVRITDIGEEDGQQYLAMEYVAGLDLKRYIKEHYPLSNEEAVRIMGQI
LLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVP
QALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLLKVS
QSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVAASLI
WILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPGAGTG
RKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIKIEEEESNESEAGTV
LKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENLIKIE
EEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLI
QIVGIKEANIEVVEVTTAPAGSVEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatcggcaagatttttgccggacgctatcggattgtcaaacagattggtcga
ggaggcatggcggatgtctacctagccaaagacttaatcttagatggggaagaagtggca
gtgaaggttctgaggaccaactaccagacggacccgatagctgtagctcgttttcagcgt
gaagcgagagctatggcagatctagaccatcctcatatcgttcggataacagatattggt
gaggaagacggtcaacagtatcttgcaatggagtatgttgctggactagacctcaaacgc
tatatcaaggaacattatcctctttctaatgaagaagccgtccgtatcatgggacaaatt
ctcttggctatgcgcttggcccatactcgaggaattgttcacagggacttgaaacctcaa
aatatccttttgacaccagatgggactgccaaggtcacagactttgggattgctgtagcc
tttgcagagacaagtctgacccagactaactcgatgttgggctcagttcattacttgtca
ccagagcaggcgcgtggttctaaggcgactgtgcagagtgatatctatgccatggggatt
attttctatgagatgttgacaggccatatcccttatgacggggatagcgcggtgaccatt
gccctccagcatttccagaaacccctgccgtccgttattgcagaaaatccatctgtacct
caggctttagaaaatgttattatcaaggcaactgctaaaaagttgaccaatcgctaccgc
tcggtttcagagatgtatgtggacttgtctagtagcttgtcctacaatcgtagaaatgaa
agtaagttaatctttgatgaaacgagcaaggcagataccaagaccttgctgaaggtttct
cagagtaccttgacatctattcctaaggttcaagcgcagacagaacacaaatcaatcaaa
aacccaagccaggctgtgacagaggaaacttaccaaccacaagcaccgaaaaaacataga
tttaagatgcgttacctgattttgttggccagccttgtattggtggcagcttctcttatt
tggatactatccagaactcctgcaaccattgccattccagatgtggcaggtcagacagtt
gcagaggccaaggcaacgctcaaaaaagccaattttgagattggtgaggagaagacagag
gctagtgaaaaggtggaagaagggcggattatccgtacagatcctggcgctggaactggt
cgaaaagaaggaacgaaaatcaatctggttgtctcatcaggcaaacaatccttccaaatt
agtaattatgtcggccggaaatcttctgatgttatcgcggaattaaaagagaaaaaagtt
ccagataatttgattaaaattgaggaagaagagtccaatgagagtgaggctggaacggtc
ctgaagcaaagtctaccagaaggtacgacctatgacttgagcaaggcaactcaaattgtt
ttgacagtagctaaaaaagctacgacgattcaattagggaactatattggacggaactct
acagaagtaatctcagaactcaagcagaagaaggttcctgagaatttgattaagatagag
gaagaagagtccagcgaaagcgaaccaggaacgattatgaaacaaagtccaggtgccgga
acgacttatgatgtgagtaaacctactcaaattgtcttgacagtagctaaaaaagttaca
agtgttgccatgccgagttacattggttccagcttggagtttactaagaacaatttgatt
caaattgttgggattaaggaagctaatatagaagttgtagaagtgacgacagcgcctgca
ggtagtgtagaaggcatggttgttgaacaaagtcctagagcaggtgaaaaggtagaccta
aataagactagagtcaagatttcaatctacaaacctaaaacaacttcagctactccttaa

DBGET integrated database retrieval system