KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1039.11cHelp
Entry
SPAC1039.11c      CDS       T00076                                 

Definition
(RefSeq) putative alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00052  Galactose metabolism
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPAC1039.11c
   00500 Starch and sucrose metabolism
    SPAC1039.11c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SPAC1039.11c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Phage_G
Motif
Other DBs
NCBI-GeneID: 5802985
NCBI-ProteinID: NP_001342938
PomBase: SPAC1039.11c
LinkDB All DBs
Position
I:complement(5471561..5474548)
Genome map
AA seq 995 aa AA seqDB search
MFIHRMKSNLASLFLSFFLLLACEFTFSYADFSTTTSDATHPSATATEDIFSTPAVPSLG
LAQNPSVYEPYRGDKCGGYNAIQVSEYEKGVLAILQLNGDPCYAYGTDYPFLALNVSFDS
IDRLHVSIQDLYGAQFQFSKRTDVWDAPLYHFQPQFGDRTYNFSFNSQPFEFWVTRVSDG
EVLFDTRGHKLIFEDQYIELTTNMVDDYNVYGLAETVHGLRLGNNLTRTFWANGNPTPLD
RNAYGTHPFYLEHRYTPSENLNSDGQPSYTSSTHGVLMLTANGMEVLLRPNYLQYRIIGG
IVDLYIYVGGTKNPKDTVSQFVQSVGTPAMQQHWTFGFHICRWGYKNVFDLVEVKENFKN
FEIPVDTFWSDIDYMYEYRDFTVESNAFPKDKMMEFFNSLQQSNQHYVPIIDAAIYAANP
INRSDDVYYPYYEGVRRDIFLRNPDRSLYVGNVWPGFTTFPDFTNPETTNYWTECLMNLS
AAFGYNSSFPLPYSGLWIDMNEPTSFCIGSCGTDKLDQNPVHPAFILEGEPNNMVYMYPE
GFEHTNASEHASAYQASVSQYYATATSTVESVKATSTPLNVRPKYNINYPPYALNTEQGE
GDLSNLGVSVNATYHDGTVRYNLFNTYGYDQSRVTYDSLTSIEPNVRPFILSRSTFVGSG
KYAAHWLGDNYSLWSNMIFSIPGALTFNMVGLPMVGADVCGFMGNTDEELCSRWMALGAF
LPFYRNHNSLGSISQEPYRWESVAESSRCAMNIRYSLLPYWYTLMYEASSQGLPLIRPLF
FEFPNEPSLANADRQFMVGSALLVTPVLEPNVDYVRGVFPGDNSTIWYDWYDHKVIYRQH
NENITLSAPLTHINVAIRGGNIIPMQKPSLTTHETKQNPYDLLVALDSDRKACGSLYVDD
GVSIQQESTLFVKFVANGDSLSIESYGDLQVHEPLSKITIIGLPCAPIGVYFEGVQVESF
SYLEDTKELVLTNLEAFTSTGAFSNNWTISWNLPV
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgttcatccatcgaatgaagtcgaatttagcttctttgtttttatcttttttcttgcta
cttgcttgtgaatttactttttcttatgcagacttttcaactaccacttcagatgccaca
cacccatccgcaactgcaactgaagacattttttccacccctgctgtgccatctttaggc
cttgctcagaatccatctgtttatgaaccataccgtggagataaatgtggtggttataat
gcaatccaagtttctgaatacgaaaaaggagttctagcaattttacaactcaacggagat
ccctgctatgcatatggtacggactacccgtttttggcactcaacgtttcttttgactca
attgaccgtttacatgtgtccatacaggatctctatggagcacaattccaatttagcaag
cgaacagatgtttgggatgcccctctgtatcattttcaacctcaatttggagatcggact
tacaacttttcattcaactctcagccgtttgagttttgggtgactagagtatctgatggt
gaagtcctttttgatacacgaggtcacaaattaatttttgaagaccagtatattgaatta
accaccaacatggttgatgactataacgtgtatggactagccgaaaccgttcacggttta
cgacttggtaacaatttaaccaggactttttgggcaaatggaaatcccacgcctttggat
aggaatgcctatggaacccaccccttctatttagaacatcgttatactccatctgaaaat
ttaaattcggatggacaaccttcttacacttcttccactcatggcgttctcatgctcact
gccaacggaatggaagtacttcttcgtccaaactatttacaatacagaataattggagga
atagtcgacttgtatatatacgttggaggaacaaagaatcctaaggacacagtatctcag
tttgtacaatctgtcggaacgcccgcaatgcagcagcattggacttttggatttcacatt
tgccgttggggatacaagaatgtgtttgacttagtagaagtcaaagaaaatttcaaaaat
tttgaaattcctgttgacaccttttggagtgatattgattatatgtatgagtatagggat
ttcacagttgaatctaatgccttccccaaagacaaaatgatggaattctttaactctttg
caacaaagcaatcaacattatgttcctatcattgacgctgctatttatgctgcaaatcct
ataaacagaagtgacgatgtttattatccatactacgaaggggtacgaagggacattttc
ctaagaaatccagatagatctttgtacgttggaaacgtatggcctggttttacaactttc
ccggacttcacaaatccagagacaaccaactattggactgaatgcttaatgaacctttca
gcagcattcggttataactcttctttcccacttccttacagtggactatggattgacatg
aacgaacccacttcattttgtattggatcatgtggaacagataaactagatcaaaatcca
gttcatccagcattcatcttggaaggagaaccaaacaacatggtatatatgtatcctgaa
ggctttgaacatacaaatgcctccgaacatgccagtgcataccaggcgtctgtgagtcaa
tattacgctaccgcgacttctactgtagaaagcgttaaggcaacatctactcctttaaac
gttagacctaagtataacatcaattatccaccttacgctctcaatactgagcagggtgaa
ggtgatttatccaatttaggagttagcgttaatgcaacttaccatgacggaacagttaga
tacaatcttttcaacacttatggttatgatcaatcacgtgtaacctacgactcgctcaca
tcgatagaaccaaacgtacgccctttcattttgtcacgttcaacttttgtaggatccgga
aaatatgcagctcactggcttggcgataattattcactatggtcaaacatgatattttct
ataccgggcgctcttacatttaatatggtaggacttcctatggtcggagctgatgtttgc
ggctttatgggtaatactgatgaagaactttgttcacgttggatggctttaggcgcattc
cttccgttttacagaaaccacaatagccttgggtccatttcccaagaaccttacagatgg
gagtccgttgcagaatcttcacgttgtgcaatgaatatcagatattccttactcccttac
tggtacacacttatgtacgaagcatcatcacaaggattaccccttattcgtccactcttt
ttcgaatttcccaatgaaccgtccttggcaaatgctgacaggcaatttatggttggcagt
gctttattggttactcccgttttagagccaaatgttgattatgttcgtggtgttttcccg
ggtgataatagtacgatatggtatgattggtatgatcacaaagtcatttatagacagcat
aatgaaaacattacgctgagtgccccattgactcatatcaatgttgctattcgtggagga
aatattattccaatgcaaaagccttcgttaacgacccatgagactaagcaaaatccttac
gatttactagttgccttggattctgacagaaaggcttgtggatccttgtatgttgatgat
ggagtatctattcaacaagaatcaacactttttgtgaaatttgttgctaacggagactca
ctgtcaattgagagttacggagatttacaagttcatgaaccactttccaaaataaccatt
ataggccttccatgtgcgccaattggtgtttattttgaaggcgtacaagtagaaagcttc
agttatcttgaagatactaaagaacttgttctaacaaacttagaagcttttacgtcaaca
ggtgcgtttagcaacaactggacgatcagttggaatttgccagtctaa

DBGET integrated database retrieval system