KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1556.02cHelp
Entry
SPAC1556.02c      CDS       T00076                                 

Gene name
sdh1
Definition
(RefSeq) putative succinate dehydrogenase Sdh1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00020  Citrate cycle (TCA cycle)
spo00190  Oxidative phosphorylation
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01130  Biosynthesis of antibiotics
spo01200  Carbon metabolism
Module
spo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPAC1556.02c (sdh1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPAC1556.02c (sdh1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPAC1556.02c (sdh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 2541690
NCBI-ProteinID: NP_594319
PomBase: SPAC1556.02c
UniProt: Q9UTJ7
LinkDB All DBs
Position
I:complement(join(3796400..3798226,3798348..3798446))
Genome map
AA seq 641 aa AA seqDB search
MLRFRKVAPSLKNGGNLKLFSTSSTLKKIASSQPLRAKQVSTSESVKYPVIDHTYDAIVV
GAGGAGLRATFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTKDDWRWHFYDTV
KGSDWLGDQDAIHYMTKEAPKAVLELEHFGVPFSRTKEGKIYQRAFGGQSLEYGKGGQAY
RCAAVADRTGHSILHTLYGQSLKHNTNFFIEYFAMDLIMEGGECRGVIAMNLEDGSIHRF
RAHKTILATGGYGRAYFSCTSAHTCTGDGNAMVSRAGLPLQDLEFVQFHPTGIYGAGCLI
TEGCRGEGGYLLNSKGERFMERYAPTAKDLASRDVVSRAMTVEIREGRGVGPEKDHCYLQ
LSHLPAEILKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRFTGEVLTIDEN
GKDKIVPGLYAAGEAACVSVHGGNRLGANSLLDIVVFGRACALHIKDTLEPNTPHKPLAA
DAGLDSLKFLDQIRTSQGPKHTSEIRLDMQKTMQRDVSVFRMEETLQEGVKNIARVDGTY
KDIGIRDRGLIWNTDLVEALELRNLLTCAVQTANAALNRKESRGAHAREDYPERDDKNWI
KHTLTWQHKTGDPVTLKYRAVTRTTMDENEVKPVPPFKRVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgctcagatttcgaaaagtcgctccaagtctaaaaaatggagggaatctgaagctattt
tctacttcttcaactttaaaaaaaatagcttcaagccagcctttaagagcaaagcaagtt
tcaacatcagaatccgttaaatatccagtcattgaccatacatacgatgctatcgttgta
ggtgccggaggtgccggtcttcgtgctacttttggtttggcagaagccggctttaatact
gcatgtattactaagctctttcctacgaggtcccatactgtcgctgcccaaggtggtatc
aacgctgcactcggtaatatgacaaaagatgactggcgctggcatttctatgacactgtc
aaaggatcagattggttgggtgatcaagatgctattcattacatgactaaagaagcaccc
aaagcagttttggagttggaacattttggtgtacctttttcaagaacgaaggagggaaag
atttatcaacgtgcttttggcggtcaatcccttgaatatggtaaaggtggacaggcatat
cgctgtgctgctgttgccgatcgtactggacattctatcttgcacactctttacgggcaa
tctcttaaacataacacaaacttttttattgagtattttgcaatggatttaatcatggaa
ggtggtgaatgtcgtggtgtcattgctatgaatttggaagacggtagtattcacagattc
cgtgctcacaagactattttggctactggtggttatggacgtgcctatttctcttgcacc
tcagctcatacctgtactggtgatggtaatgccatggtttctcgtgctggacttcctcta
caagatctcgagtttgttcaatttcaccctactggtatctatggtgctggttgtttaatt
actgaaggttgccgtggtgaaggtggttatcttttgaacagcaagggtgagcgttttatg
gaacgctatgctcctaccgctaaggatttggcttctcgtgatgtcgtttctcgtgctatg
actgttgaaattcgtgaaggccgtggtgttggccctgaaaaggatcattgttatttgcag
ctttctcacctccccgctgaaattttgaaagagcgtcttcctggcatttccgaaactgct
gctatctttgctggtgtagatgttactaaagagcctatccccgttttacctacagttcac
tacaatatgggtggtattcctacccgtttcaccggtgaagtcctcactattgacgaaaat
gggaaggataagattgttcctggattgtatgctgctggtgaagctgcttgtgtatctgtc
catggaggtaaccgtcttggtgccaactctcttctggacattgttgtttttggacgtgcc
tgtgctttacatattaaggatacgcttgaacccaatacccctcataaaccgcttgcagct
gatgccggattggattctctaaaatttttggaccaaattcgcacttcgcaaggccctaaa
cataccagtgaaattcgtttggatatgcaaaagacgatgcaacgtgatgtctcagttttc
cgtatggaagaaactcttcaagaaggtgttaagaacattgctcgtgttgacggcacttac
aaggatattggaatcagggaccgtggtttaatctggaacaccgatcttgttgaagccctt
gaattacgtaaccttttaacttgtgctgtgcaaactgctaatgcagctctcaaccgcaaa
gaatctcgcggtgcccatgctcgtgaagactatcctgagcgtgatgacaagaattggatc
aagcatacattgacttggcaacacaaaacaggcgaccctgtcaccttgaagtatcgcgct
gtcaccagaaccactatggatgagaatgaagttaaaccagtgcctcctttcaaacgtgtt
tattag

DBGET integrated database retrieval system