KEGG   Schizosaccharomyces pombe (fission yeast): SPAC26F1.04cHelp
Entry
SPAC26F1.04c      CDS       T00076                                 

Gene name
etr1
Definition
(RefSeq) putative enoyl-acyl-carrier-protein reductase etr1
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00061  Fatty acid biosynthesis
spo00062  Fatty acid elongation
spo01100  Metabolic pathways
spo01212  Fatty acid metabolism
Module
spo_M00874  Fatty acid biosynthesis in mitochondria, fungi
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SPAC26F1.04c (etr1)
   00062 Fatty acid elongation
    SPAC26F1.04c (etr1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     SPAC26F1.04c (etr1)
    1.3.1.-  
     SPAC26F1.04c (etr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N PALP ATPase
Motif
Other DBs
NCBI-GeneID: 2542100
NCBI-ProteinID: NP_594891
PomBase: SPAC26F1.04c
UniProt: Q10488
LinkDB All DBs
Position
I:5178325..5179443
Genome map
AA seq 372 aa AA seqDB search
MSFFKTAVRRFSSTSITRGMAKAIAYSEYGNPKEVLRAVSYNVPKCSKNQVNVRFLASPI
NPSDINQIQGVYPSKPPFTNDVCSSKPSAVAGNEGLVEVVDVGDQFKGTFSPGQWAILGS
VNLGSWRTEMNIDGRSLVPVDKSAFPSIAEAATLSVNPCTAYCLLQHVVQLNKGDWFIQD
GANSMVGIATIQLAKHFGYKSINVVRNRPDIEKLKEQLKSLGATIVITDEELMDRKTMKQ
KVPEWIQGGEVKLGIDCVSGRVAAEMAKYMSKGATMATFGGMSRQPLPVPVSLLIFKNLK
FHGFWVTKWKSEHPEEFLKIIHKVEDFYRNGTLKTVNTELVSLKEDADEKTFLDTFLNAI
EGHGKKIIKFEH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctttaaaaccgctgttcgtcgcttttcatccacttcaattactaggggaatg
gcgaaagcaattgcatattcagaatacggtaatccaaaagaggttttgcgagccgtatcc
tataatgtgcccaagtgttcaaagaatcaggtgaatgttaggtttttggcttctcccatc
aacccatctgatattaatcaaatccagggcgtttacccttctaaaccccctttcaccaac
gatgtttgctcctccaaaccctctgctgtcgctggaaacgaaggtttggtcgaggttgtc
gatgttggggatcagttcaagggtactttttctccaggccaatgggcaatcctaggatcc
gtcaacttgggttcttggagaacggaaatgaacattgatggaagatctctcgtccctgtt
gacaagtcggcctttcccagtatcgccgaagctgccacgctttctgtgaatccctgtaca
gcatattgtttacttcaacatgttgtccaattgaacaaaggcgactggtttattcaggat
ggcgcaaatagtatggttggaattgcaacgattcaattagcaaaacactttggctacaaa
agtattaacgttgtccgaaatcgtcccgatattgaaaagttaaaggagcaacttaagtcc
ttgggtgctactatcgtcattactgatgaagagctgatggatcgcaaaaccatgaagcaa
aaggtccctgaatggattcaagggggagaggtaaaactgggtattgactgtgttagtgga
cgtgtagcggctgaaatggccaagtacatgtccaaaggagccactatggcaacctttgga
ggaatgtctcgtcagcctctacctgtcccggtgtctttattgatatttaaaaatctaaaa
tttcatggcttctgggtcaccaagtggaaatctgagcacccagaagagtttttgaagatt
attcacaaagttgaagacttttatcgtaatggcactttaaaaaccgtcaacactgaattg
gtttctcttaaagaagatgccgatgaaaaaactttccttgatacatttctcaatgctatt
gaaggacatggcaaaaaaataataaaatttgaacactaa

DBGET integrated database retrieval system