KEGG   Schizosaccharomyces pombe (fission yeast): SPAC30D11.01cHelp
Entry
SPAC30D11.01c     CDS       T00076                                 

Definition
(RefSeq) putative alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00052  Galactose metabolism
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPAC30D11.01c
   00500 Starch and sucrose metabolism
    SPAC30D11.01c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SPAC30D11.01c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 2542098
NCBI-ProteinID: NP_593216
PomBase: SPAC30D11.01c
UniProt: Q09901
LinkDB All DBs
Position
I:1120548..1123529
Genome map
AA seq 993 aa AA seqDB search
MLLFKFNFTTAFLFTILAFAQARSHSSSSSSTSKSSASHHSSINSTSATSVYDFSSLTTP
IVPTNGVAQEPTLYESSRGLSCPGYQARNISEYSYGVLAILELAGDACYAYGTDYPYLLL
NVSYDTEERVHISISDLNQTQFQLSNRRDVWDAPLFYRSSNFSGNLQYNFSFNTDPFEFW
ITRIADDQVLFDTRGNPLIFEDQYIELTTNMVEDYNVYGLSGSQQSFRLGNNLTKTFWAT
GYSDSPEANMYGSHPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMI
GGIIDLFVYSGSTVSPKYTIQQYVQSIGTPTMQPYWSLGFQMSRWGYKTLSDLINMRSYL
NASNIPTEGFWNDIDYMSEFRTFTVNSTAFPPNQTLDFFRSLDESHQHYVPVLDPAIYAA
NPNKSADRTYYPYYSGFEDNIFIKNPNGSAYVGMAWPGFVVYPDFTNPAVLQYWKQGILN
LSTAFGSNYSYDLPFSGLCLDMNEPTSFCIGSCGSDLLKLNPVHPPFSLPGDVDNKVYSY
PEDFNATNTTEYKSVSRASQSQYKATATSEKSHETPSSESLINGKPEFSINYPPYALDTD
TETHDLAQFGVSPNATMHGNTLRYNLFNTYGYSESKISFEALNSIQPNIRPFLLSRSTFV
GSGRYAAHWLGDNKSQWSDMVSSISSILTFNLLGIPMVGADVCGYNGNTDEELCARWMAL
GAFLPFYRNHNSLGSIPQEPFRWASVAEASRSAIEIRYSLLPYWYTLMHTASVDGTPMVR
PLFFEFPKQISLASVDKQFMIGTALLISPALEPNTTYIQGIIPGDNDTIWYDWYNHSVIN
HDYDENITMSAPLGYVNIAVRGGNIIPLQQPGYTTYESRNNPYSLLIAMDNNGFASGSLY
IDDGISMQTNSSLSVKLNSNSNTITCVVSGTMVSSPSLANITILGLSNPPNTILFNGQQL
SDYQYSDQTLSLTNLLDLTVDGAFSKNWTVTWS
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgttcaagtttaatttcactacagcttttttatttacgatcctcgcttttgct
caagcccgctctcactcttcctcctcctcttccacctccaagtcgagtgcaagtcatcat
tcaagtattaattccacctcggcaacctctgtctatgatttctcctccttaactacgccc
atcgttccaacaaatggcgtcgctcaagaacccacattatatgagtcttcccgagggttg
tcttgcccgggttatcaagcccgaaacatctctgaatactcgtacggtgtcttggcaatt
ttggagctggctggagatgcttgctacgcatacggtactgattacccctatttattattg
aacgtttcctatgatactgaagaacgcgttcacatatcaatttccgacttaaaccaaacg
caattccagctcagtaatcgccgggatgtttgggatgctcccttattctatcgtagttcc
aatttttctggaaatctgcaatacaatttttcattcaacacagacccctttgaattttgg
attacaaggattgcggacgatcaagtcttgttcgatactcgtggaaaccctttgattttt
gaggaccaatacattgaattgactactaatatggttgaggattataatgtgtatggtctc
tctggaagtcaacagtctttccgtttaggaaataacttgactaaaactttttgggcaaca
ggttatagcgattcaccagaggctaatatgtatggctcacatcctttctatatggagcaa
cgctatattcccataggaactaccaatacctatacttctgcctctcatggagtccttatg
ctaagttcaaatggaatggaggtacttttgagaagtacttacattaaatatagaatgatt
gggggcatcattgatttatttgtatactcaggaagtacggttagcccaaaatatactatt
caacagtacgttcaatcgattggtactccaactatgcagccctactggtccttgggtttt
caaatgtcccgatggggctacaaaacgctatcggatcttattaatatgcgcagctacctt
aatgcttctaatattcctaccgaaggcttttggaatgatatagattacatgagtgaattt
cggacttttactgttaacagtaccgcattcccacctaaccagactttagatttctttcgc
tctttagatgaatctcatcagcattatgtaccagtccttgatcctgcaatatatgcagca
aatcctaataaatctgctgatagaacttactatccttattatagtggttttgaagacaat
atttttataaaaaatcctaatgggtctgcttatgttggtatggcttggccaggctttgtt
gtatatcccgattttacgaatccggcggttcttcaatactggaagcaaggaatacttaat
ttatctactgcttttggctctaattattcatatgacttaccatttagcggcctttgttta
gacatgaatgaaccaacttctttttgtatcggttcatgtgggtccgaccttttgaaactg
aatccagttcatccaccattttctctgccaggagatgttgataataaagtttacagttat
cccgaggattttaatgctaccaatacgactgagtacaagtctgtttctcgggcttcacag
agtcaatataaagccactgcaacttctgaaaaatcacatgaaacaccttcaagtgaatct
cttattaacggaaagccggagtttagtatcaactatcctccttatgccttagacacagat
actgagactcacgacttggctcaatttggcgttagtcctaatgcaacaatgcacggcaat
acattaagatataatttgttcaacacatatggctactcagaaagcaagatctcttttgag
gcacttaattcaattcagccaaacattaggcctttccttttgagccgctcaacctttgtt
ggttctggacgatatgccgcacattggcttggtgataataaatcacaatggtccgatatg
gtttcctctatttcgagtatacttacttttaatttattgggaataccaatggttggagca
gatgtttgtgggtataatggtaataccgatgaagagctttgtgcgcgttggatggcttta
ggagcttttcttccattttatagaaatcataatagtctaggttccattccacaagagccg
ttcagatgggcttctgtcgctgaggcatctagaagcgctatcgaaatacgctacagttta
ttgccgtattggtacactttaatgcatacagcttctgtcgatggtacacctatggtgcgt
cctttgttctttgaattcccaaaacaaatctcactagcaagtgtggataagcagtttatg
attggaactgcattgctgatatccccagcgttagaaccaaacacgacatatattcaaggt
atcattcctggagataatgatactatttggtacgattggtataatcattcggtaataaac
catgattacgatgaaaatattactatgagtgcaccacttgggtatgtcaatattgccgtt
cgtggaggaaatatcattcccttacagcaacccggttatactacatatgagtcgcgcaat
aatccttatagcttgcttatagctatggataataatgggtttgctagtggtagtttatat
attgatgacggaatttcgatgcaaacaaactcatctctctctgtcaaactaaattctaat
tcaaatacgattacgtgcgtagtatcaggaaccatggtttcgtccccatctttggccaac
attacaatccttggtctttcaaacccaccaaatactatactatttaatggtcagcaatta
agcgattatcaatattcagaccagactctttcgttaacaaatctactagatttgacagtc
gacggtgccttttctaaaaactggactgtaacatggtcatag

DBGET integrated database retrieval system