KEGG   Schizosaccharomyces pombe (fission yeast): SPAC821.10cHelp
Entry
SPAC821.10c       CDS       T00076                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase Sod1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SPAC821.10c (sod1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPAC821.10c (sod1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 2542128
NCBI-ProteinID: NP_593163
PomBase: SPAC821.10c
UniProt: P28758
LinkDB All DBs
Position
I:complement(1002999..1003463)
Genome map
AA seq 154 aa AA seqDB search
MVRAVAVLRGDSKVSGVVTFEQVDQNSQVSVIVDLVGNDANAKRGFHIHQFGDNTNGCTS
AGPHFNPEGKTHGDRTAAVRHVGDLGNLESDAQGNIKTTFSDSVISLFGANSIIGRTIVI
HAGEDDLGKGTSEESLKTGNAGARNACGVIGIAV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttagagctgtagcagttcttcgtggtgactctaaggtcagtggtgtcgttactttt
gaacaagtcgatcaaaactctcaagtttctgtgattgtggatctcgttggcaatgacgct
aatgccaagcgtggtttccatattcaccaattcggtgataataccaacggttgtacctct
gctggtcctcactttaacccagagggtaagactcacggtgaccgtaccgccgctgttcgt
cacgttggtgatcttggtaacttggaaagcgatgctcagggcaacatcaagactactttc
tctgattctgttatctcattgtttggtgccaacagcatcattggccgtaccattgtcatt
catgccggtgaggatgatcttggtaagggtactagtgaagagtctttgaagactggtaac
gctggtgcacgtaacgcttgtggtgtcattggtattgccgtctaa

DBGET integrated database retrieval system