KEGG   Schizosaccharomyces pombe (fission yeast): SPBC14C8.05cHelp
Entry
SPBC14C8.05c      CDS       T00076                                 

Gene name
meu17
Definition
(RefSeq) glucan-alpha-1,4-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPBC14C8.05c (meu17)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SPBC14C8.05c (meu17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 2539682
NCBI-ProteinID: NP_595908
PomBase: SPBC14C8.05c
UniProt: O60087
LinkDB All DBs
Position
II:complement(2212020..2213372)
Genome map
AA seq 450 aa AA seqDB search
MRTYWLFLLLGGVVSAESLLSPNKRSKEASMDEWTDQQKGIAMGHMLNNIGDSGMHAKDI
NPGCIIASPSTDSPDYYYQWVRDSALTIMTILDRFFEGDKGLEPIIVKYMDEMVRLQKVP
NPSGDFYAGGLGEPKFNVDGTSYDGDWGRPQNDSPALRAIAFIKYMNYLFENGKEVHEVT
VWIEAVLADLDYTANHWTEASFDLWEEIKDVHYFTLAVQKRAMQDGTAFAKRIGAPDQAA
LYQRTIEPIDLKLGEFWDPGMGVIKGYKGRVDRSGLDCSTLLASLYSNEFDMHILPTLLK
LQETMTRDYPVNQGWKQAMGRYPEDVYDGVSKSIGNPWFICTSSAAEIIYKAIAYYDNKG
LPELTEYNIHFFMKFAEFGDPYNWSVIRKNMHTYADNFLKAVAEFQHPNGSMSEQFSRDD
GHQKGARDLTWSYSSLLNAIYRREAIKGSV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacatactggttattcttactccttgggggggtcgtatctgcagaaagcttactt
tcccctaataaaagaagcaaggaagcttctatggatgaatggacggatcagcaaaagggt
attgctatgggacatatgctgaacaatatcggtgacagcggtatgcatgctaaggatatt
aatcctggatgtattattgcttccccttcaactgattcccctgattactattatcaatgg
gttcgtgatagtgcattgacgatcatgactattttagatcgtttctttgaaggggacaaa
ggacttgagccgattatcgtcaaatatatggatgaaatggtcaggctccaaaaggtcccg
aacccaagtggagacttttacgccggaggtcttggtgagcctaaatttaatgttgatggg
acaagctatgacggagattggggacgtccccagaatgattcccctgctcttcgggctatt
gcatttatcaaatacatgaattatttatttgaaaatggtaaagaggtccatgaagttact
gtctggattgaggctgtattagccgacttggattatactgcaaatcactggacagaggca
agctttgatctttgggaagaaattaaggacgttcattactttactctagccgttcagaag
cgtgccatgcaagatggtacagcttttgcaaagagaattggagcacctgaccaagccgca
ctctaccaacgcacgatcgagcctattgatctaaaactgggagagttctgggatcctgga
atgggtgttattaagggttataaaggcagagtcgatcgctcaggacttgattgctccact
ttgcttgcaagcctttactcaaatgagtttgatatgcacatccttccaaccttgttgaag
ttgcaagaaaccatgaccagagattatcccgtcaatcagggatggaagcaagcaatggga
cgctatcccgaggatgtatacgatggtgtctctaagtctattggtaacccttggttcatt
tgcacaagcagcgctgccgagattatctacaaagcaatcgcatactacgataataaaggt
ttaccagaattgactgaatataacatccatttctttatgaaatttgctgagtttggagat
ccatacaactggtccgttatcaggaaaaacatgcacacatatgctgataactttttaaaa
gctgttgctgagttccaacatccaaatggttcaatgtctgaacaattttcgcgtgacgat
ggtcaccaaaaaggtgcaagagatttgacatggagttattcatccttattaaatgccatc
tacagaagagaggcaatcaaaggctctgtctaa

DBGET integrated database retrieval system