KEGG   Schizosaccharomyces pombe (fission yeast): SPBC14F5.13cHelp
Entry
SPBC14F5.13c      CDS       T00076                                 

Definition
(RefSeq) putative alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00730  Thiamine metabolism
spo00790  Folate biosynthesis
spo01100  Metabolic pathways
Module
spo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SPBC14F5.13c
   00790 Folate biosynthesis
    SPBC14F5.13c
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC14F5.13c
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spo00537]
    SPBC14F5.13c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SPBC14F5.13c
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC14F5.13c
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spo00537]
 Enzymes
  SPBC14F5.13c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 2539926
NCBI-ProteinID: NP_596739
PomBase: SPBC14F5.13c
UniProt: O60109
LinkDB All DBs
Position
II:complement(join(4182792..4184185,4184320..4184524))
Genome map
AA seq 532 aa AA seqDB search
MASERDPLLPVHGEGPESPSRRNWKTWIKHGILLILVLSTVIFFYFFSSHKSKGTNEKPK
FVIMMVSDGMGPGSLSMTRSFVETLNDKEGYRLPLDEHLIGSSRTRSSSSLITDSAAGAT
AFSCANKTYNGAVGVLDNEKPCGTILEAAKEAGYLTGIVVTSRVTDATPASFSAHAANRF
MQDLIAEYQVGMGPLGRSVDLLFGGGLCSFLPKSTYRSCRSDNLDLLKYARKKEGFQILL
NRTDFDELSNAQLPLLGLFSDYHLSYDIDYQPEVQPKLSEMVETALDVLLNATNEDTSKG
FFLLIEGSRIDMASHNNDPIAHVYEVMEYNRAFEIASAFVEKNGGSLISTSDHETGGLTV
GRQVSKKYPEYLWKPQVLSLALHSIEYLASAIVNHNQNTLLPYIEQFVLPAIGIPDPNPK
QIHDIYVARHNIFNLINVLSDIVSVEAQIGWTTHGHTAVDVNVYGVGEVTEHLRGNMENI
EIGQFMEIYLNVSLSDVTEKLKDAPIHGAPDRPSLVETSFSDRLVGFGADLF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgagcgcgatcctcttctgccagtgcatggcgagggtccggagagcccttct
cgtagaaattggaaaacttggataaaacatggaattctgttaatccttgttttatcaacc
gttatatttttttattttttctcgtctcataagtccaaagggaccaatgagaaaccaaaa
tttgttattatgatggtttctgacggaatgggacctggctctttgtctatgactagatcg
tttgtagagactctaaacgataaagagggttataggcttcccttggatgagcatttaatt
ggcagttcacggacacgttccagttcgagtttgattacggatagtgcagccggagcaacc
gcattttcttgtgctaataaaacctacaacggagctgttggtgttttggataatgaaaaa
ccttgtggaactatcttagaggctgctaaagaagccggttacttaaccggaattgttgtc
acaagcagagttaccgacgctacacctgcctctttctctgctcatgccgcgaatcgattc
atgcaagatttaattgctgagtaccaagtcgggatgggacctttgggaaggagtgttgac
ttattgttcggtggtggactttgttcattcttacctaaatctacttatcgatcatgtaga
tccgataacttggatcttttgaaatatgctaggaaaaaagaaggtttccaaattttgctt
aatagaactgactttgatgagctatcaaacgctcaattgcctttgcttggtttgttttct
gattatcatctcagttatgatattgattatcagcctgaagtgcaacctaagctttctgaa
atggtagagacggctttggatgttttgctcaacgccactaatgaagatacatctaaagga
ttttttttgctcatagaagggagtagaattgacatggcctctcacaacaatgaccctatc
gctcatgtttacgaagttatggaatacaacagggcctttgaaatagcaagtgcatttgta
gaaaagaatggaggatctttaatctctacatcggatcatgaaactggtggtttgactgtt
ggtcgccaggtctccaaaaaatatccagagtatttatggaagccgcaagtcctatctctt
gctctccattctattgaatatctcgcttcagctatcgtgaaccataaccaaaatacgttg
cttccttatattgaacagtttgttttacccgcaattggcattcctgaccctaatccaaag
cagattcatgacatatacgtggcccggcataatatatttaatcttataaacgtgcttagt
gatattgttagtgtagaagcacaaattggctggaccactcacggccatactgctgtcgat
gtaaacgtttatggagtaggagaggtcactgaacatcttcgaggaaatatggagaacatt
gaaattggacagtttatggagatatacttaaatgtttcactaagcgatgtaactgaaaag
ctcaaagatgctcccatacatggtgccccagatcgacctagtttagtggaaacttcattt
tccgatcgtcttgtaggtttcggtgctgatttgttttaa

DBGET integrated database retrieval system