KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1683.07Help
Entry
SPBC1683.07       CDS       T00076                                 

Gene name
mal1
Definition
(RefSeq) maltase alpha-glucosidase Mal1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00052  Galactose metabolism
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPBC1683.07 (mal1)
   00500 Starch and sucrose metabolism
    SPBC1683.07 (mal1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SPBC1683.07 (mal1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Alpha-amylase_C hDGE_amylase Glyco_hydro_42C
Motif
Other DBs
NCBI-GeneID: 2539976
NCBI-ProteinID: NP_595063
PomBase: SPBC1683.07
UniProt: Q9P6J3
LinkDB All DBs
Position
II:153562..155301
Genome map
AA seq 579 aa AA seqDB search
MKVVPSEKIKPNWWRETSVYQIYPASFKDSNGDGFGDLEGIISKVDYLKALNVESIWLCP
IYPSPLKDMGYDVSDYKQIDSRYGTLEDLDRLMKALHERDMKLVMDLVLNHTSDQHEWFK
ESRSSKTNPKRDWYFWKPARYNEKGERLPPNNWRSYFDTSAWEWDEATQEYYLHLWSVGQ
PDLNWETPKVREAVHDILRFWLDRGVDGFRLDAINMISKDQRFLDAPITDDRYEYQLAYQ
YYANGPRIHEYLNGIGNILTEYDAFSVGEMPYVLDTNEILHVVGADRRELTMIFQFDFVD
LDLDPNQHKYIEGSWELSDLKKSLKKWQSALLSGGGWNASFIENHDQTRTVSRYLSDSPK
YRAYSSKLMALFIIFQSGTPFVFQGQELALANIPRDWPIDEYLDVETQNFWKLFMSGNPS
QEEIEKTMDIVNKRARDNGRTPMHWDSSPNGGFTKAGVKPWMRVTNDYKEWNAANQVNDP
ESPYTFWSKALELRKELKDAVVYGSFELISEEDPSIVAFVRESSTYKLIILLNFTGNKVS
YDCPLNLTSYEILLDNYKDFICMTSPVTLNPYQAVLLKL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgccaagcgaaaaaatcaaaccgaattggtggagagagacttcagtatat
caaatatatcctgcctctttcaaagattcaaacggtgatggctttggtgatttagaagga
atcatttccaaagtggattatctgaaagctctaaatgtagagtctatttggctttgtcct
atttacccatctcctctaaaagacatgggttatgatgtttctgattacaaacaaattgac
tctcgatatggaactttagaggatttggacaggctaatgaaagctctacacgaaagggac
atgaagttagttatggacttggtgttaaaccacacttctgatcaacatgagtggtttaag
gagtccagatcttctaaaacaaatccgaagcgagattggtacttttggaaaccagctagg
tacaatgaaaaaggcgaacgcttacccccaaataattggagaagctatttcgatacttcg
gcgtgggaatgggacgaagctacgcaagaatactacctacatctttggtccgtagggcaa
cccgatcttaattgggaaaccccaaaagttagggaagcggtacacgatattctacgtttc
tggcttgatagaggagtagatgggtttcgacttgatgctattaacatgatcagcaaagac
caaaggtttctagatgctccaattactgatgacaggtacgaatatcaactagcctatcaa
tattacgccaatggtcccagaattcacgagtatcttaatgggataggcaatattcttaca
gagtatgacgctttttctgtaggggaaatgccttacgttttggatacgaacgaaatcctg
catgtcgttggtgctgatcgtagagaactgacgatgatatttcagtttgattttgtggac
cttgatctcgatcctaatcagcataagtatattgaaggaagttgggagctttctgatttg
aaaaagtcattaaaaaaatggcagtctgcactactttccggtggtggttggaatgcttcc
tttattgaaaatcacgaccaaacgagaactgtttcacgatatctttctgattctcccaag
tatagagcatatagctccaaattgatggctctttttatcatattccaaagtggtacccca
tttgtattccagggtcaggaacttgctcttgccaatatcccacgagattggccgattgat
gaataccttgatgttgaaacgcagaacttctggaaactttttatgagtggcaatcctagt
caggaagaaattgagaagactatggacattgttaacaaacgtgctcgtgacaacggtcgc
acaccaatgcattgggatagctcacccaacggtggtttcacaaaggctggagtaaaaccg
tggatgagagtgactaatgactacaaagaatggaatgctgccaatcaagttaatgaccct
gaaagtccttacacattttggtcaaaggcattggagcttcgtaaagaattgaaggatgct
gttgtgtatggatcgtttgaattgatatctgaagaggatccatcgattgttgcatttgtt
cgtgaatcatcgacttataaactcatcattcttttgaatttcacgggtaataaagtttct
tatgactgtcctttgaacctgacttcctatgaaattctacttgacaactataaggacttt
atttgtatgacttctcctgtcacattgaatccttatcaagcagtcttgttaaagctctaa

DBGET integrated database retrieval system