KEGG   Schizosaccharomyces pombe (fission yeast): SPBC713.06Help
Entry
SPBC713.06        CDS       T00076                                 

Gene name
adl1, lig3
Definition
(RefSeq) DNA ligase (predicted)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC713.06 (adl1)
   03410 Base excision repair
    SPBC713.06 (adl1)
   03420 Nucleotide excision repair
    SPBC713.06 (adl1)
   03430 Mismatch repair
    SPBC713.06 (adl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC713.06 (adl1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC713.06 (adl1)
Enzymes [BR:spo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SPBC713.06 (adl1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     SPBC713.06 (adl1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SPBC713.06 (adl1)
DNA replication proteins [BR:spo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SPBC713.06 (adl1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SPBC713.06 (adl1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SPBC713.06 (adl1)
   NER (nucleotide excision repair)
    Other NER factors
     SPBC713.06 (adl1)
   MMR (mismatch exicision repair)
    Other MMR factors
     SPBC713.06 (adl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 2541111
NCBI-ProteinID: NP_595345
PomBase: SPBC713.06
UniProt: Q9C1W9
LinkDB All DBs
Position
II:877504..879828
Genome map
AA seq 774 aa AA seqDB search
MPPKKRMKNGSSLKSTSKKGEKSRNIITIQDLFSKREAQLTDTPNKLLTDHDQSASDYAY
ALKLQQLFDSENQATAPEKLPKDVIIPEEEYHTDTFNVVKESNDKPKENLVTSEECKASF
FSTDSVNKDSTIDYDALQKDPLTYVKSCRARFVSKDTKSFSYSSLANTFSLISSTKSRIR
IVTLLTNFLLTLLYADPDSLIATVWLCTNSIAPNFYGKNLGVGPAMYSKALKEVCGITAS
ALKNLWNKYGDPGDVAFEAKVSVRTLSRPEPLTIKKVYSTLLKIADSNGNGAQNRKLELT
KFLLISSNAEEVRYIGRSIMQNLRIGAVQNTMLASLSKAFFIFDNQNEIFNFNSDSLQQQ
FRQGEEIVKQSFFQVPDYNILVATLLREGIENLKDNMSIRPGIPVKPMLGSITKNLQHML
ERLTDHNFSCEFKYDGQRAQIHCDRLGNIKIFSRHLEEITGRFPDVIEVAQLALKHSCDF
IIEGELVAIDKSNGQILDFQKLSTRERKKVTVADITIDVCVFVFDIMFCDGKSCLQMPLI
ERRRMFFEHFNLIPNRFQFVSSLETNEEQSIQEFFSLAITNKCEGLMVKVLNGTNSKFPS
TYEPDKRGEGWIKVKQDYDDEFESLDLVPIGAWYGNGRKAGWFSPILLAVYNPDTGAYEA
VCKCMSGFSDQFYKELTQKYSLESGNSSLKPIYNFCETGKVTPQIYFAPQEVWEIKGAQI
TSSPAYKAALGLIQDDRGLSIRFPRFIRVRSDKGPEDASTNSILADMYMKQLNT
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaaaagcgcatgaaaaatggctcttctttaaaatctacgtctaaaaagggt
gagaaaagccgaaatattattacaattcaagatttgttttcaaaacgagaagcacagctt
acagatacaccaaacaaattgctcaccgatcacgatcaaagcgccagcgattatgcttat
gcattaaagcttcaacagctttttgattctgagaaccaagctactgctccggaaaagctt
cctaaagatgtaattatacctgaagaagagtatcatactgacacatttaatgttgtaaaa
gaaagcaatgataaacctaaggagaatttagttacaagcgaagaatgcaaagcttctttt
ttctcaactgatagcgtgaacaaagattccacaattgattacgatgctttacagaaagat
cctttgacttacgtgaaaagttgtcgagcccgatttgtttcaaaagatacaaaaagcttc
agttactcatcacttgctaacaccttttccttaattagttctaccaaatccaggatacgc
attgtcacattattaaccaatttccttctcacacttctgtatgcagatcctgattcctta
attgcaacagtttggttatgtaccaattctattgcccccaacttttatggaaaaaacctt
ggtgtcggacctgcaatgtactctaaagctttgaaagaagtttgtggcattacagcaagt
gctttgaaaaatttatggaacaaatatggcgatccaggagatgtagcgttcgaagctaaa
gtgtctgtgcgcacgttaagcagaccagaacctttgactattaagaaggtttattctact
ttactaaagattgctgacagtaacggtaatggtgcccagaaccgtaaattagagttaact
aaatttttattgataagttctaatgctgaggaggttcgatatatagggaggagtataatg
caaaatctaagaataggggctgttcaaaacaccatgttagcttcactaagcaaagctttt
tttatttttgacaatcaaaacgaaatatttaattttaattctgactcacttcaacaacaa
tttcgtcaaggagaagagattgttaaacaaagtttctttcaggtccctgattataacatt
ttggttgcaacccttcttcgagaggggatagaaaacttaaaagacaatatgtctattcgc
cctggaatcccagtaaaacctatgcttggttctatcacaaagaatttgcagcatatgtta
gaaagattgactgatcataacttctcttgtgagttcaagtacgatggacaaagagcacaa
attcattgcgatagacttggaaacattaagatatttagccgccatttggaggaaattaca
ggaagatttccggatgtcattgaagttgctcaattagcattgaaacattcatgtgatttt
attatagaaggcgaattggtggctattgacaaaagtaatggtcagatactggattttcaa
aaactttcaactagagaaagaaaaaaagttacagtggctgatattacaatagacgtgtgt
gtttttgtttttgatattatgttttgtgatgggaaatcttgcttacaaatgcctttaatt
gaaagaagaagaatgttttttgagcattttaatttaattccaaatcgctttcagttcgtg
tcttctttggaaacaaatgaggagcaatccattcaagaattttttagtcttgcaattact
aataaatgcgaaggattaatggtgaaggtactgaatggaacaaactcaaagtttccttca
acgtatgaacctgataaaagaggtgagggatggattaaagtcaaacaggattatgatgat
gaatttgagtcattggatcttgttcccataggcgcttggtacggtaatggaagaaaagcc
ggatggttcagtccaattttgcttgctgtttacaatccagacactggcgcgtatgaagca
gtctgtaaatgcatgtccggttttagtgaccaattttataaggaattaacacaaaagtat
tccttagaatctggcaatagcagtcttaaacccatatataatttttgcgaaacaggtaag
gtaactccacaaatatactttgcccctcaagaagtttgggaaattaagggtgctcaaata
acatcctcacctgcatacaaggcggctttgggattaattcaggatgatcgcggtttatca
attcgattcccacgcttcattagagttcggtcagacaaaggaccagaggacgcatccacg
aattcaatattggctgacatgtatatgaaacaacttaatacttga

DBGET integrated database retrieval system