KEGG   Schizosaccharomyces pombe (fission yeast): SPCC965.07cHelp
Entry
SPCC965.07c       CDS       T00076                                 

Gene name
gst2
Definition
(RefSeq) glutathione S-transferase Gst2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPCC965.07c (gst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPCC965.07c (gst2)
Enzymes [BR:spo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SPCC965.07c (gst2)
Transporters [BR:spo02000]
 Other Transporters
  Pores ion channels [TC:1]
   SPCC965.07c (gst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 2539601
NCBI-ProteinID: NP_588517
PomBase: SPCC965.07c
UniProt: O59827
LinkDB All DBs
Position
III:complement(2295375..2296067)
Genome map
AA seq 230 aa AA seqDB search
MAHFTLYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVD
HKNNDYTIWESDAILIYLADKYDTDRKISLSFDDPEYYKLIQYLFFQASGQGVIWGQAGW
FNFFHHEPVVSAVTRYRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLF
GEGKFSFKEEVPQLDFEKEFPKAYAWNQRLLARPAVKATFEELAKAKEQH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctcattttactttatactcgcatgctggaggacccaatccttggaaggtggtcctt
gctttgaaagaattgaatctttcttacgaacaaatattttatgatttccaaaaaggagaa
caaaaatgcaaggaacacttggctttaaaccccaatggaagagtacctactttagttgac
cacaaaaacaatgattatactatttgggaatcagacgccattttgatttatttggctgac
aagtatgatacggatcgaaagatttcattatcctttgatgaccctgaatactataaactt
atccaatacttgttcttccaagcttctggacaaggcgttatttggggtcaagctggatgg
ttcaactttttccatcatgagccagtggtatctgcagtcacccgttatagaaatgagata
aagcgtgttcttggagtacttgaagatattcttaaagatcgtgattatcttgtagcgaat
aagtatacaattgctgatttatcgtttattccttggaactacaaccttggcggtcttttc
ggggaagggaaattttcattcaaggaagaggttcctcagcttgattttgaaaaagagttt
cctaaagcttacgcttggaatcaaagacttcttgcacgacctgctgtcaaggctactttc
gaagaattggcaaaggccaaagaacaacattga

DBGET integrated database retrieval system