KEGG   Sporanaerobacter sp. NJN-17: EQM13_02685Help
Entry
EQM13_02685       CDS       T05805                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
spoa  Sporanaerobacter sp. NJN-17
Pathway
spoa00040  Pentose and glucuronate interconversions
spoa00051  Fructose and mannose metabolism
spoa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EQM13_02685
   00051 Fructose and mannose metabolism
    EQM13_02685
Enzymes [BR:spoa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     EQM13_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_2 FAD_binding_3 AlaDh_PNT_C ADH_N_assoc CoA_binding GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: QAT60559
UniProt: A0A410Q9B7
LinkDB All DBs
Position
539587..540627
Genome map
AA seq 346 aa AA seqDB search
MKAAVFHGIEDIRIEEREIPKIDDDGILIKVSYCAICGTDVRIYFNGQDNVIPPRITGHE
ISGVIDSIGKNVQGYKVGDKVVVVPQIACGKCFECLRGNSNMCNSADVIGYGLDGGFAEY
MAVPGKAVEHGNVIKLEKDQDLKFSCIAEPLSCVINGHKNLNIKLGDDVLIVGAGPIGTM
HALLSKAQGATRVILADIEENRLNLAHELGTDFVIDTSKTDLYEEVNEITKGQGVDVGIA
ACSVPSVQSQVLSVIKKGGKALFFAGLPKGKSINPIDTNIIHYKEISLYGSFGSTITQHI
TALKLINSKVINADRLITTILPIDKLVDGIKMVRRGEGLKIAIKMS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggtttttcacggtatagaagatataagaatcgaagaaagagaaattcct
aaaatagatgatgacggtattttaataaaagtcagctattgtgctatatgtggaactgat
gtaagaatatattttaatgggcaagataatgtaattccaccgagaataacaggccacgaa
atttctggagtaattgattcaataggaaaaaatgtgcaaggatataaagtaggggacaag
gttgtagtagttcctcaaattgcctgcggaaaatgttttgaatgtttaagaggaaatagc
aatatgtgcaattcagcagacgttatcggctacgggcttgacggaggatttgcagaatac
atggccgtccccggaaaggcagtggaacatggaaatgtaataaagcttgagaaagatcag
gatttaaaattttcgtgcatagcagaacctctttcctgtgtaataaacgggcataagaat
ttaaatataaaattaggagatgatgtattaatcgtaggtgccggacctatcgggacaatg
cacgcgcttctttcaaaagcccaaggagcaacccgtgtaatattagcagatatcgaggag
aacagattaaatttagctcatgaattgggtactgattttgtaatagataccagcaaaaca
gatctatatgaagaagttaatgaaataactaaaggtcagggggtggatgtaggtatcgca
gcgtgttcagttccatctgttcagagtcaggtattgagtgttataaaaaaggggggaaaa
gctcttttttttgctggtcttcctaaaggtaaatctataaatcctatagatacaaatatt
attcattataaagagatatcattgtacggatcctttggttcaactataactcagcatatc
acagcacttaagttgataaattcaaaggttataaatgcagataggctgataactacaata
cttccaattgataaacttgtagacgggattaaaatggtaagaagaggagaaggacttaaa
atagcaataaagatgtcataa

DBGET integrated database retrieval system