KEGG   Sporanaerobacter sp. NJN-17: EQM13_08170Help
Entry
EQM13_08170       CDS       T05805                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spoa  Sporanaerobacter sp. NJN-17
Brite
KEGG Orthology (KO) [BR:spoa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spoa01001]
    EQM13_08170 (pknB)
Enzymes [BR:spoa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EQM13_08170 (pknB)
Protein kinases [BR:spoa01001]
 Serine/threonine kinases: Other
  Bacterial family
   EQM13_08170 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 Pkinase_fungal Haspin_kinase YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: QAT61555
UniProt: A0A410QC35
LinkDB All DBs
Position
1709006..1710937
Genome map
AA seq 643 aa AA seqDB search
MIGKLLGGRYEIIEKIGGGGMALVYKARCRLLDRYVAIKVLREEFTSDEEFIRKFRRESQ
AAAKLSHPNIVSIYDVGVEGDIYYIVMEYIKGKTLKEVIREKGKLSFEETVDYSIQIAEA
LAHAHANHIVHRDIKPHNIMITEDGRVKVTDFGIARAATSSTVTNTNNVLGSVHYFSPEQ
AKGGYTDEKSDIYSLGIVMYEMITGRVPFEGESPISVALKHVQEEIVPPSHIDPTINKNL
EKIIMKCVRKDQVERYKSANELLVDLKRIKNNWDDDMVGEDDVSLDSPTRIIPVVKEESP
KNMKKKKKKRNGNNRVVFFAILAAFLLVSAMAFGFWQFKDKFLSTTVKVPDVRGLQEDKA
KEMIEAEGLKFSVKSRIFNSEFEEGDVISQSENPGDTVKKGYPIEVVVSKGSKLVKVPNF
KDEDISNVDSLLSENGLKDGGAEYEFDEEIPENIIISQDPEAYSEVPEGTKVHFVVSKGP
KVKNVIMPKLVGKTLEEALQIIKEKGLTKGEVVPQPSDEVEEGKVIWQSYEQGNEIEEGT
AVDLYVSSGKGGGSGDNNGDNDDKDNPDDNKEISSDLNITIPQDKSQTEVKVLKIDGGAS
TVYYDRIHYPSDGTIVIPIKGTKNTKFEVYFDNTLQATKTLVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgattggaaagttgttaggcggaagatacgaaattattgaaaaaatcggcggcggtggt
atggcacttgtatataaagcaagatgtagattgcttgacagatatgtagcaataaaggtt
ttgagagaagaattcacttcagatgaagaatttattagaaaattcaggagagaatctcag
gcagcggcaaaactatcccatcccaatatagtaagtatttatgatgtaggtgtagaaggg
gatatttattatatcgtcatggaatatataaagggcaagactttaaaggaagtcatcaga
gaaaaaggaaaactttccttcgaggagacggttgactattcgattcagatagcagaagct
ttagcccatgctcatgccaatcatattgttcacagagatataaagcctcataatataatg
attacagaggacggaagggttaaggtaacggattttggaatagcacgggctgcgacatct
tctaccgttacaaatactaataatgttttaggctcagttcattacttttctccggaacag
gcaaaaggcggatatacggatgaaaagtccgatatctattccctgggaatagtgatgtat
gaaatgattacgggaagggttccttttgaaggggaaagcccgatttccgttgcattaaaa
catgttcaggaggaaatagtaccaccttctcatatagaccccaccattaacaaaaatctt
gaaaagattataatgaaatgtgtcagaaaagaccaagtggaaagatataaaagtgcaaat
gaacttctggttgatttgaaaagaattaaaaataactgggatgatgacatggttggagaa
gatgatgtttcattagactcacctaccagaattatacctgttgtgaaggaggagagtcct
aaaaacatgaagaagaagaaaaaaaagagaaacggaaacaatagggttgtattttttgca
atacttgctgcatttcttcttgttagtgccatggctttcggattttggcaatttaaagat
aagtttctctctacgaccgtgaaagtcccggatgtaaggggacttcaggaagataaggct
aaggaaatgattgaggcagaagggctgaaattttcggttaagagcaggatattcaattcg
gaatttgaggaaggagatgtcatttctcaaagtgagaatcctggagatactgtcaagaaa
ggatatcctatagaggttgtggttagcaagggaagtaaactcgtaaaagtacctaatttt
aaggatgaggatataagcaatgtagattccctgttgtctgagaacggtcttaaagatggc
ggagcagagtatgaatttgacgaagaaataccggaaaatataattataagtcaggacccg
gaagcatattcggaggtaccggaaggtacaaaggtacattttgtcgtaagcaaggggccg
aaagttaaaaacgtgattatgccgaaacttgtaggaaagacccttgaagaggcattacag
attataaaggaaaagggcttaactaagggagaagttgtacctcagcccagtgatgaagta
gaagaaggcaaggttatatggcaaagctacgagcagggaaatgaaattgaagaaggtacc
gcagttgatttatatgtaagcagcggaaaaggcggaggatcaggagacaataacggagat
aatgatgataaagacaatcctgatgataataaagaaatttccagtgatttgaatataaca
atacctcaagataagagtcaaaccgaagttaaagttcttaaaatagacggaggagcaagt
actgtttactatgataggattcactatccttccgacggaaccattgttatacctataaag
ggaactaaaaatactaagtttgaagtatactttgataatactttgcaggcaaccaaaact
ttggttgattga

DBGET integrated database retrieval system