KEGG   Sporanaerobacter sp. NJN-17: EQM13_12945Help
Entry
EQM13_12945       CDS       T05805                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spoa  Sporanaerobacter sp. NJN-17
Pathway
spoa00473  D-Alanine metabolism
spoa00550  Peptidoglycan biosynthesis
spoa01100  Metabolic pathways
spoa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spoa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EQM13_12945
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EQM13_12945
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EQM13_12945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spoa01011]
    EQM13_12945
Enzymes [BR:spoa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EQM13_12945
Peptidoglycan biosynthesis and degradation proteins [BR:spoa01011]
 Precursor biosynthesis
  Amino acid ligase
   EQM13_12945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp RimK ATPgrasp_YheCD ATP-grasp_4 Catalase-rel
Motif
Other DBs
NCBI-ProteinID: QAT62405
UniProt: A0A410QEK9
LinkDB All DBs
Position
complement(2689131..2690288)
Genome map
AA seq 385 aa AA seqDB search
MKKKVAVIFGGRSVEHEVSVISGLQVLENIDESKYTAVPLYINKEGKWFTGDSLRKFKNY
KENNLNDLKEIVVVPTNNDYNLYTQPESVGLFGKKIIESVDVAFPVIHGTNGEDGTIQGV
FELMNIPYVGGGVLSSSVGMDKVLMKDVFKANNLPVVNYVWFYRSMWEENRNEIINNIKN
KLEFPLFVKPANLGSSVGISKAKDEDSLISAIEIAVRYDRKIIIEKAVEEPREINCAVMG
YEDNVDVSLCEEPLGWKELLSYEDKYIKSNIKNNKTEKRRIPADLEDVIRAEIEKIAKNA
FQVIDGRGNARIDFLLDKNQKIYINEINTMPGSIAYYLWEGKGYSFKTLIDKMIDIAFKA
HDDKNKNMYSYNEDLFNKIQFGGKA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggtagcagttatatttggcggaagaagtgttgaacatgaggtgtcggtt
ataagcggacttcaggtacttgaaaatatagatgagagtaaatatacagctgtcccgctc
tatataaataaggaaggtaaatggtttacgggggacagtttgagaaaatttaaaaattat
aaggaaaataatttgaatgatttaaaggaaatagtagttgttcccacaaataatgattat
aatttatatacacagcctgaaagtgtcggattgtttgggaaaaaaattatagagagtgtt
gatgttgcttttccagttatccatggaacaaacggagaagacggaacaattcagggagtt
tttgaattaatgaatattccttatgttggtggcggagtattgtcttcaagtgttggaatg
gataaggtacttatgaaggatgtgtttaaagcaaataaccttcctgtagtaaattatgtc
tggttctatagatctatgtgggaagaaaatagaaatgaaataataaataatataaaaaat
aaacttgaatttcctcttttcgtaaagcccgctaatttaggttcaagcgtggggatatct
aaagcaaaggatgaggacagcctgataagtgctattgaaattgctgtaagatatgataga
aagataattatagaaaaggccgtggaagaacccagagagattaactgtgcagttatggga
tatgaagataatgtggatgtgtcattatgtgaagaacccctgggctggaaagaactttta
tcctatgaagataaatatataaaaagcaatataaaaaacaacaaaaccgaaaaaagaagg
atacctgcggatttggaagatgtaataagagccgaaatcgaaaagatagctaaaaatgct
ttccaagtaatagatggaagaggaaatgcaagaatagattttctccttgataaaaatcag
aagatctatattaatgaaatcaatacaatgcccgggtctattgcttattatttatgggaa
gggaaaggatattcatttaaaaccttgattgataaaatgattgatatagcttttaaagca
catgatgataaaaataagaatatgtattcttataatgaagatctatttaataaaatacaa
tttgggggtaaagcataa

DBGET integrated database retrieval system