KEGG   Spongiibacter sp. IMCC21906: IMCC21906_00344Help
Entry
IMCC21906_00344   CDS       T03945                                 

Definition
(GenBank) ATP dependent DNA ligase-like protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi03030  DNA replication
spoi03410  Base excision repair
spoi03420  Nucleotide excision repair
spoi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    IMCC21906_00344
   03410 Base excision repair
    IMCC21906_00344
   03420 Nucleotide excision repair
    IMCC21906_00344
   03430 Mismatch repair
    IMCC21906_00344
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spoi03032]
    IMCC21906_00344
   03400 DNA repair and recombination proteins [BR:spoi03400]
    IMCC21906_00344
Enzymes [BR:spoi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     IMCC21906_00344
    6.5.1.6  DNA ligase (ATP or NAD+)
     IMCC21906_00344
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     IMCC21906_00344
DNA replication proteins [BR:spoi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    IMCC21906_00344
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     IMCC21906_00344
DNA repair and recombination proteins [BR:spoi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     IMCC21906_00344
   NER (nucleotide excision repair)
    Other NER factors
     IMCC21906_00344
   MMR (mismatch exicision repair)
    Other MMR factors
     IMCC21906_00344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AKH68037
UniProt: A0A0F7M121
LinkDB All DBs
Position
375226..376110
Genome map
AA seq 294 aa AA seqDB search
MPILLHWPQGFLLGFLLSLSTAIAADTNSNHAIPSNTDSPPLMLANSYHSAIDLDDYWVS
EKLDGVRAYWNGRHLISRGGQVFTAPSWFTQDFPDQPLDGELWMGRGRFAEVSGAVRRQT
PNPQQWRQIHFMVFDLPAHKGDFNHRLAAMQTLFAKTSSPYIQLVKQQKMATKAQLMTHL
DTLIAQGAEGLMLHLGTAPYRAKRSDDLLKLKRYQDAEATVVKHLPGKGKYQGMMGALLV
EMPNGRQFKLGSGFSDDQRRQPPAPGTTVTYKYYGLTNSGLPRFASFMRIRRGH
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcctatactgctgcactggccacaagggtttctgctcggttttttactcagcctctcg
accgcaattgccgccgacaccaattcaaaccacgcgataccaagcaacaccgactcgccc
ccactgatgttggccaatagctaccacagcgccatcgaccttgacgattattgggtaagc
gaaaagctcgacggggtcagagcgtactggaacggccgccatctcatcagccggggtggc
caggtgtttaccgctcctagctggtttacccaggattttcccgatcaaccgctagatggc
gagctgtggatggggcggggccgctttgccgaagtctccggtgccgtccgacggcaaaca
cccaacccgcaacaatggcggcaaattcactttatggtttttgatttgccagcccacaaa
ggcgatttcaatcatcgcctggcagccatgcagacactatttgcaaaaacgtcctctccg
tatattcagctagttaaacaacagaaaatggcgaccaaagcacaattgatgacgcattta
gataccctgattgcccaaggcgccgaagggctaatgcttcaccttggcactgcgccctat
cgagcaaaacgcagcgatgatttactcaaactcaaacgctatcaagatgccgaagccacc
gtcgttaaacaccttcctggcaagggtaaatatcagggaatgatgggcgccctgttagtc
gagatgcccaacggcaggcagtttaaacttggcagcggcttctccgacgatcaacgccgg
cagcctcccgcccccggcaccacagtaacgtataaatactacggcttaaccaacagtggc
ctgccccgttttgccagctttatgcggattcgtcgcggccattaa

DBGET integrated database retrieval system