KEGG   Spongiibacter sp. IMCC21906: IMCC21906_00623Help
Entry
IMCC21906_00623   CDS       T03945                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spoi  Spongiibacter sp. IMCC21906
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IMCC21906_00623
Enzymes [BR:spoi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     IMCC21906_00623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 HI0933_like GIDA FAD_oxidored DAO Thi4 FAD_binding_3 Glutaredoxin FMO-like K_oxygenase Thioredoxin_9 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKH68316
UniProt: A0A0F7M051
LinkDB All DBs
Position
669014..670597
Genome map
AA seq 527 aa AA seqDB search
MLDTNMKEQLQGYLQNLKTPVELLAYLGDDDKSRELGELIDELTSLSPLVTAARGDDSEA
RVPSMTVRSVAKNTELRFAGIPLGHEFTSLVLALLHSGGHPIKLDEEVIRQVAELEGEYS
FETFISLSCQNCPDVVQALNMMAAINPNIHHEMIDGALFQDEVDSRKVMAVPSVFLNGES
FSQGRVSIGDILKKVDKNAAARSVKKLAEKDRFDMLVVGGGPAGAAASIYSARKGIRTGI
VADRFGGQVLDTVGIENFISVSATEGPKLVANLEEHVKDYDVDIMAGHSAEGLSVQQDGS
LEVAVEGGVSLRSRSVLLATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKSVAVIG
GGNSGIEAAIDLAGITEHVTVLEFDRQLRADEVLQRKAKSMANIEIILNAQTTEVVGNGE
KVTGLNYIDRVSGDARSVKLAGIFVQIGLIPNTEFLKDSGIALSPRGEIIINEKGETSIP
GVFAAGDATTVHYKQIIIAMGAGAAGALSAFDYLIRSSVAGEEEQAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagacacaaatatgaaggaacagctgcaaggctacttacagaacctgaagaccccg
gtcgagctgctggcgtatttgggtgatgatgataagtcccgtgagcttggcgaactgatc
gatgaacttacatcgttgtcgccgctggtgactgcggccagaggtgatgacagcgaagct
agagtgccgtcgatgactgtgcgttcggtggctaaaaataccgagctgcgatttgctggt
attccgctggggcatgaatttacgtcactggtattggcgttgctacacagcggtggccac
cctattaagctggacgaagaggtgattagacaggttgcagaactcgaaggtgagtacagc
ttcgagacgtttatttctttaagctgccagaattgccccgacgtcgttcaggcactgaat
atgatggcggccatcaaccccaatattcaccatgaaatgatcgatggcgccttgtttcaa
gacgaggttgatagccgcaaagtgatggcggtgccatcggtctttttgaatggcgaaagt
ttttctcaaggtcgggtgagcattggcgatatccttaaaaaagtggataaaaatgctgct
gcccgcagcgttaaaaagctggctgaaaaagaccgttttgatatgttggtggttggtggt
ggtcccgctggtgcagcggcgtcgatttactcggcgcgcaaagggattcgcactgggatt
gtagccgatcgctttggtggtcaggtgctggacacggtcggcattgagaattttatctcg
gtgagcgccaccgagggtccgaagctggtggccaatctggaagagcacgtcaaagattat
gacgtcgatattatggcgggccacagcgcggaagggttaagcgttcagcaagatggcagc
cttgaagtggcagttgaagggggtgtgagtttgcgcagccgttcggtgctgctggcaacg
ggtgcccgctggagagaaatgaatgtacccggtgaacaagaataccgcggtaagggtgtt
gcctactgcccgcattgcgatgggccactgtttaaaggtaaatctgttgcggtgattggc
ggtggtaattctggcattgaggcagcgattgatttggcaggcattaccgagcacgtcacg
gtgctggagtttgatcgtcagctccgggccgatgaggttctgcagcgcaaggcgaagtcc
atggccaatatcgagattattctcaacgcccaaacaacggaagttgtcggcaatggcgag
aaagtcaccggtttgaactacattgaccgcgtgagcggtgatgcccgcagcgtcaaattg
gcggggatatttgtgcaaattggcttgatacctaataccgagtttcttaaagacagcggt
atagccttgagtcctcggggtgaaattattatcaatgaaaaaggcgagacctctattccc
ggcgtgtttgctgcaggcgatgccaccactgtgcattataagcaaatcattatcgcgatg
ggtgcgggggccgctggagctttaagcgcctttgattacttgattcgcagctctgtcgct
ggcgaagaggagcaggcagcttga

DBGET integrated database retrieval system