KEGG   Spongiibacter sp. IMCC21906: IMCC21906_02339Help
Entry
IMCC21906_02339   CDS       T03945                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi00020  Citrate cycle (TCA cycle)
spoi00270  Cysteine and methionine metabolism
spoi00620  Pyruvate metabolism
spoi00630  Glyoxylate and dicarboxylate metabolism
spoi00680  Methane metabolism
spoi01100  Metabolic pathways
spoi01110  Biosynthesis of secondary metabolites
spoi01120  Microbial metabolism in diverse environments
spoi01130  Biosynthesis of antibiotics
spoi01200  Carbon metabolism
Module
spoi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spoi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spoi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IMCC21906_02339
   00620 Pyruvate metabolism
    IMCC21906_02339
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC21906_02339
  09102 Energy metabolism
   00680 Methane metabolism
    IMCC21906_02339
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    IMCC21906_02339
Enzymes [BR:spoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     IMCC21906_02339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AKH69999
UniProt: A0A0F7M6Y7
LinkDB All DBs
Position
2492522..2493502
Genome map
AA seq 326 aa AA seqDB search
MKQPVRVTVTGAAGQIGYALLFRIASGSMLGEDQPVILQLLDITPALDALQGVKMELEDC
AFPLLAGVVCTDDPNVGFKDSDYALLVGARPRGPGMERKDLLEANAAIFSVQGKAIDQNA
SKDIRVLVVGNPANTNALITQRNAPSIPARNFTAMTRLDHNRAMTQIAQKTGKTVNDVTN
MTIWGNHSATQYPDLFNAKVDGKTASDLVDQAWLESDFIPTVQQRGAAIIKARGASSAAS
AANAAIDHMRSWALGTEGDDWVSMGVYSDGSYGIAEGLIYSFPCRCKDGQWEIVQGVEVN
EFSRGKMDATAQELTEERDGVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacccgttcgcgtcaccgttacaggtgcagccggccagattggctacgctctt
cttttccgcatcgcctccggttccatgctgggcgaagaccaacccgttattttacaactg
ctggacatcactcctgctcttgacgccctgcaaggcgtgaaaatggagctggaagattgc
gcattcccactgctggccggtgttgtttgcactgacgatcccaatgttggttttaaagac
tctgattatgctctgcttgttggtgcccgccctcgcggtcccggcatggagcgtaaagac
ctgctagaagccaacgcagcgatcttctcggtacaaggcaaagccattgaccaaaacgcc
agcaaagacatccgcgtattggttgtcggcaacccagccaacaccaacgccctgattact
cagcgcaacgcaccgtctattcctgctcgcaacttcaccgcaatgactcgccttgatcac
aaccgcgccatgacgcaaattgcccagaaaaccggcaaaaccgtcaatgacgtcaccaac
atgaccatctggggcaaccactctgccactcagtatccagacctgttcaatgctaaagtc
gatggcaaaacagcatctgacctcgttgatcaagcctggctggaaagcgacttcatcccc
actgttcaacagcgtggcgcggcgatcatcaaagcacgtggcgcctcttctgccgcctct
gctgccaatgctgccattgaccatatgcgcagctgggcactgggcaccgaaggtgacgac
tgggtatcaatgggcgtttacagtgacggcagctacggcatcgccgaaggcctgatctac
tctttcccttgccgctgcaaagacggtcagtgggaaatcgttcaaggtgttgaagtaaat
gagttcagccgcggtaaaatggacgcgacagctcaagaactgaccgaagagcgtgacggt
gttaagcaccttctgccctaa

DBGET integrated database retrieval system