KEGG   Spongiibacter sp. IMCC21906: IMCC21906_02687Help
Entry
IMCC21906_02687   CDS       T03945                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
spoi  Spongiibacter sp. IMCC21906
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKH70332
UniProt: A0A0F7M809
LinkDB All DBs
Position
complement(2870228..2871721)
Genome map
AA seq 497 aa AA seqDB search
MNTKISHAEVPLAHPDCLFIDGAWVKPLSGKMFDIKSPATEALYMQVAEASEDDINLAVT
AARNAFDSGPWSQMTHAKRASYLRAMADELAKRSDDVANIWPNEMGIVHAVAGAFSATIP
DVYRYYADLSESFPFEEAFPNPPGGGEIALLVKEPVGVVGTIIPWNAPINIMAYTIAPAL
LAGCTVVLKSSPEAPGGGYIMAEIAEAIGLPAGVLNVVTADREASERLVRHPGVDKISFT
GSNVAGRKIGAICADRIARCTLELGGKSAAVILDDYDLKEAAEAIGSFSCFLSGQVCSSL
TRVIVTKDRHDEFVAALTAVYANIKIGDPFDPETQLGPLVSERQLARVEEYIEIAKNEGA
TLAFGGERPADLDQGFYIQPTLFSNVGNDFRIAREEVFGPVLCVIPAENEEHAIELANDT
VFGLNNSVFTNNIDRAYAVARQLRSGTVGHNVFRSDMMIGFGGFKQSGIGRQGGVAGLAA
YLENKTVILNDIPSHVV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaaaatatctcatgcagaagtgccacttgcgcatccagattgcctttttata
gacggagcttgggttaagcctctgtcaggtaaaatgtttgatattaagtcaccggctact
gaagcgctttatatgcaagttgcagaagcatcagaagacgatattaacttggccgttacc
gccgctcgcaatgcctttgatagcgggccgtggtcgcaaatgacgcatgccaagcgtgca
tcttatctccgagcaatggctgatgaattggctaagcgatctgatgacgttgccaatatt
tggccaaatgaaatgggtattgttcatgcggttgccggtgctttttcagcgacgattccc
gatgtctaccgttattacgcggatttaagtgagagctttccctttgaagaggcgtttcct
aatcctccgggcgggggggaaattgcactattggtaaaagagccggttggtgtagtcggt
actattattccttggaatgcgccgattaatattatggcgtataccattgcccccgcatta
ttggcggggtgcactgtggttcttaagtcctctccagaggcgcccggaggtggctatatc
atggcggagattgccgaggcgattggtctacccgctggcgtacttaatgtggtgactgct
gaccgggaagcatcggagcggctggtgcgccaccctggcgttgataaaatcagttttacg
ggctcaaatgttgcgggcagaaaaattggcgccatttgtgcggatcgcatagctcgatgc
actctagagctgggcggaaaatctgcggcggtgattctcgacgactacgatttaaaggaa
gcggcagaagctattggaagcttttcttgttttttgagtggtcaggtttgctcatcgcta
acccgggttattgtgactaaagatagacatgatgaatttgtggcggcgctaacggcggtt
tatgccaatataaaaataggtgacccctttgatccagaaacgcagttagggcctttggtt
tccgaacgccagcttgcccgagttgaagagtatattgaaatagcaaaaaatgaaggtgcg
actcttgcgtttggtggcgagcgtccagccgatcttgatcaaggtttttatattcagcca
acgctgttctctaatgtgggcaatgattttcggattgcaagagaagaggtctttggccct
gttctctgcgtaatacctgccgagaatgaggagcatgccatcgaattggccaacgatacc
gtatttggattaaacaattcggtgtttaccaataatattgatcgcgcttacgcggttgct
cggcaattacggtctggaacggttggtcacaatgtttttcgcagtgacatgatgattggg
tttggtgggtttaaacagtcgggtattggcaggcaaggtggggtagctggacttgctgcc
tatttggaaaataaaaccgttatcttgaatgatattccgtcgcacgtcgtataa

DBGET integrated database retrieval system