KEGG   Spongiibacter sp. IMCC21906: IMCC21906_03203Help
Entry
IMCC21906_03203   CDS       T03945                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi00550  Peptidoglycan biosynthesis
spoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IMCC21906_03203
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:spoi01002]
    IMCC21906_03203
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spoi01011]
    IMCC21906_03203
Enzymes [BR:spoi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IMCC21906_03203
Peptidases [BR:spoi01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   IMCC21906_03203
Peptidoglycan biosynthesis and degradation proteins [BR:spoi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   IMCC21906_03203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase LPD37
Motif
Other DBs
NCBI-ProteinID: AKH70840
UniProt: A0A0F7M5L7
LinkDB All DBs
Position
complement(3405626..3406786)
Genome map
AA seq 386 aa AA seqDB search
MLKKLLIAATVLFASAPALTQPDLIPSPPAVAASAYLLVDADSGEVLIEHNADQRLPPAS
LTKLMTSYVLSYELDRGQVSNDDMVTISKNAWAQNPVFAGSSLMWIEVGKQVNLHDLHKG
IVISSGNDSTVAVAEYLAGSEEAFAGMMNQHAKRLGMTNTHYVNSHGLPDPDHYTSPRDL
AILAKAIIQHPDEYALYSQKDFTYNGIKQTNRNGLLWTDPSVDGLKTGHTEEAGYCLVTS
AKRDGMRLISVVMGASSQSARERETQKLLSYGFRYFETHHLYASGTELTTNKVWKGSADS
VALGVKEDVYLTIPRGKSDSLNAQLNVDDTLVAPISGDEEYGELVVTLNGEQQVNVPLVA
LENVEQGSIFKRLWDSIVLFFLGLFS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaactattaatagcggcaaccgtgctgtttgcctcggcgccagcgctgacg
caaccagatcttatcccctctccacctgcggttgcagccagcgcttatttattggttgat
gccgatagtggcgaggtgctcattgagcacaatgccgatcaacgtttgcctcctgccagc
ttaaccaagctgatgaccagctatgtgctgtcatatgagttagaccgagggcaagtcagt
aacgatgatatggtaaccatcagcaaaaatgcgtgggctcaaaacccggtttttgcgggc
tcttcactgatgtggatagaggtgggtaaacaggtcaacttgcacgatctgcataaagga
atcgtgatttcttctggcaacgactccactgttgccgttgctgaatatctggcaggcagt
gaagaagcctttgccggcatgatgaatcagcatgccaaacgtttgggaatgaccaacacc
cattatgtgaattctcatggtttgcccgaccctgatcattacacgtcgccacgggatttg
gctattttggctaaggcgattattcagcaccccgacgaatatgcactgtatagtcaaaaa
gactttacctataacggtattaaacaaaccaaccgcaatggcttgctgtggactgacccc
agcgtggatggcttaaaaaccgggcatacagaagaggctggttattgtttggtgacgtca
gctaagcgcgacggcatgcgcttgatctcggtggtgatgggcgccagcagtcaatctgct
cgggagcgtgaaacccaaaagctgctgtcctatggttttcgctattttgaaacccatcat
ctctatgcttctggcactgaactgaccacaaacaaagtttggaagggcagcgccgactcc
gtggctctgggagtgaaggaagacgtttatctgacgattcctaggggtaaaagcgattct
ttaaacgcacagcttaacgttgacgacaccttggtggcgccaattagtggcgacgaggaa
tacggtgagctggttgtgaccctcaacggcgagcagcaggtgaatgtaccgctggtggcg
ttagaaaatgttgagcaaggcagtatctttaagcggctttgggacagcattgtgttgttt
tttcttgggttgttttcataa

DBGET integrated database retrieval system