KEGG   Spongiibacter sp. IMCC21906: IMCC21906_03207Help
Entry
IMCC21906_03207   CDS       T03945                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi00550  Peptidoglycan biosynthesis
spoi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IMCC21906_03207
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    IMCC21906_03207
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spoi01011]
    IMCC21906_03207
Enzymes [BR:spoi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IMCC21906_03207
Peptidoglycan biosynthesis and degradation proteins [BR:spoi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   IMCC21906_03207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKH70844
UniProt: A0A0F7M9P1
LinkDB All DBs
Position
complement(3409897..3411765)
Genome map
AA seq 622 aa AA seqDB search
MPRRQALKNTFRERLVYRRRILVSVLIVMIMTGILVARYTQLQIVDYQVYITQSDRNRIQ
LLPIAPKRGLIFDRNGVLLAENIPSYTLTVVKERVPDMEETLAGLSKLVELDEDDIEDFR
NRRGRPYQAIPLKFRLSEHEIAVVSVNRHRFPGVEIDAQLVRHYPFGDLFAHMLGYVGRI
NAQEQQEIDPVNYSGTHYIGKIGLEQYYEDILHGTVGYQNVETNAHGRILRVLERHDPLP
GGDIHLHVDAEVQRIAAKAMEGRRGAVVAIDPRDGGVVAMVSAPSYDANLFVNGISSKDY
SALRSDLDLPLYNRALQGQYPPASTIKPIWGLAGLYYGAVTPSTTYYDPGYFSLPNDSRR
YRDWKRGGHGTRVDLEQAVQESCDVYFYELAHKLGIDKLHDFGVRFGLGDVTGIDNTNER
AGLLPSREWKQRSRGVHWYPGETINVGIGQGFTLATPLQLAVMTTVLASRGELRAPRLLA
SVGEETISAPLLGKIEDMPGAHWKSVIKAMESVVHGSRGTARGLTKNLPYRLAGKTGTAQ
VVGIAAGERYDSEALELRKRDHALFIAFAPAEDPKLAVAVVIENGEHGGSVAGPVARRVL
DAYLLGDDAPDYMAEQPRVSDE
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtcgtcaggcacttaaaaataccttccgtgagcgtttggtttatcgcagaaga
atattggtgtcggtgctgattgttatgatcatgacgggaatccttgtcgcccgttatacc
cagctacaaattgtcgactaccaggtgtatatcacccagtctgaccgcaaccggattcag
ctgctgcctatcgccccaaagcggggactgatttttgatcgtaatggcgtgttgttggcc
gaaaatattcccagttataccctgactgttgttaaggaacgggtacctgatatggaggag
accctggctgggctctctaagctggtggagctggatgaagatgatattgaggactttcgc
aatcgccgggggcggccttaccaggctattcctttaaagtttcgcttaagcgagcatgaa
attgcggtggtgtcggttaatcgacaccgctttcccggtgttgagatagacgcgcagctg
gtccggcactacccctttggcgatttgtttgcacatatgttggggtatgtggggcgtatc
aatgcccaagaacaacaagagatcgatccggttaattacagcggtacccactacatcggt
aaaatcggtttagagcagtattacgaagatattttgcatggcacggtgggctatcaaaac
gttgaaaccaacgcccacggcaggatattgcgggtgttggagcgtcatgatccgctgccg
gggggcgatattcatctgcacgtcgatgccgaagtgcagcggattgcggccaaagcaatg
gaggggcgccggggcgctgttgtggcgatagacccgcgagatggcggtgtcgtggccatg
gtcagtgcgcccagctacgacgctaacttatttgtaaatggcattagctctaaagattat
tcagcgctgcgctcggatttagatttgccgttatataaccgggccttgcagggacagtat
cccccggcctccaccattaagcctatttggggtttggcgggtttgtattatggcgctgtc
accccatcgacaacgtattacgatcctggttatttctcgctgcctaatgacagccgtcgt
taccgcgactggaagcggggtggccatggcacccgagtcgatttggagcaggccgtacaa
gagtcttgcgatgtctacttttatgaattggcccacaaattaggtatcgataaactgcat
gattttggcgtccgttttggtcttggtgacgtaacgggcattgataatacgaatgagcgg
gcagggctgttgccttcccgggagtggaagcaacgtagccgtggcgttcactggtacccc
ggcgaaactattaatgtgggtattggccaaggctttaccttggcgacaccactacagctg
gcggttatgaccacggtgctggcctcaaggggtgaattgcgggcccctagactgttagcc
tcggtgggagaggagacgatctctgctccactcttggggaaaattgaagatatgccaggc
gcccactggaaatcggtgattaaggcgatggagagcgttgttcatggctcccgtggcacg
gcgcgaggcttaactaaaaatttgccttatcgtttggcaggcaagacgggcacggcacaa
gtcgtcggcattgccgcaggagagcgctatgactccgaggcgttggagctacgtaaacga
gatcatgctctgtttattgcttttgcgccggcagaggaccccaagttggcggtggcagtg
gtgatagaaaatggtgaacatgggggcagtgtggccggcccggtagcccgccgggtgcta
gatgcgtatttgctgggtgatgacgcgccagactatatggctgagcagccgagggtaagt
gatgagtaa

DBGET integrated database retrieval system