KEGG   Flagellimonas sp. HME9304: HME9304_01312Help
Entry
HME9304_01312     CDS       T05505                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
spon  Flagellimonas sp. HME9304
Pathway
spon00010  Glycolysis / Gluconeogenesis
spon00053  Ascorbate and aldarate metabolism
spon00071  Fatty acid degradation
spon00280  Valine, leucine and isoleucine degradation
spon00310  Lysine degradation
spon00330  Arginine and proline metabolism
spon00340  Histidine metabolism
spon00380  Tryptophan metabolism
spon00410  beta-Alanine metabolism
spon00561  Glycerolipid metabolism
spon00620  Pyruvate metabolism
spon00625  Chloroalkane and chloroalkene degradation
spon01100  Metabolic pathways
spon01110  Biosynthesis of secondary metabolites
spon01120  Microbial metabolism in diverse environments
spon01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HME9304_01312
   00053 Ascorbate and aldarate metabolism
    HME9304_01312
   00620 Pyruvate metabolism
    HME9304_01312
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HME9304_01312
   00561 Glycerolipid metabolism
    HME9304_01312
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HME9304_01312
   00310 Lysine degradation
    HME9304_01312
   00330 Arginine and proline metabolism
    HME9304_01312
   00340 Histidine metabolism
    HME9304_01312
   00380 Tryptophan metabolism
    HME9304_01312
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HME9304_01312
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HME9304_01312
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HME9304_01312
Enzymes [BR:spon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HME9304_01312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWX44312
UniProt: A0A2Z4LRB4
LinkDB All DBs
Position
1449582..1451135
Genome map
AA seq 517 aa AA seqDB search
MSKIATTFGIDEALEKLGLTKINEGTSTGTKNFGAGDSISSYSPVDGVLIGKVKTTTKED
YEKVMTAATSAFKEWRLKPAPQRGEIVRQFGEKLRELKEPLGKLVSYEMGKSYQEGLGEV
QEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGIISAFNFPVAVWAWNTAL
AWVCGDVCVWKPSEKTPLCGVACQNIIAQVLKENNLPEGISCLINGDYKVGELMTNDNRI
PLVSATGSIRMGKIVAQAVAARLGKSLLELGGNNAIIVTPDADIKMTVIGAVFGAVGTAG
QRCTSTRRLIIHESIYDQVKDSITDAYKQLRIGNPLDENNHVGPLIDVDAVKMYKTALEN
AKAEGGSILIEGGVLDGNGYKSGCYVKPAIVEADNSFKIVQEETFAPILYLLKYSGGVEN
AIAQQNGVVQGLSSAIMTNSLREAEHFLSAKGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKIYMRRQTNTINYTTELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattgcaacaacttttggaatagatgaagccctagaaaaactaggtttaacc
aaaataaatgaaggtacatccacaggcacaaagaattttggtgcaggagattccatatcc
tcttattctcctgttgatggagtacttatcggaaaagtgaaaaccactaccaaagaagat
tatgaaaaggtaatgactgcagcgacttctgctttcaaggagtggcgcttgaaacctgct
ccccaacgtggtgaaatagtgagacagtttggtgaaaaacttcgggaactcaaggaacct
cttggaaaattggtttcctatgaaatggggaaatcctatcaagaaggtctgggagaagtt
caggaaatgatagatatctgtgatttcgctgtcggactttccagacagttgcacggattg
accatgcattctgaaagacctggacatcgaatgtacgagcagtaccatcctttgggtgta
gtaggaattatttccgctttcaattttcccgtggccgtgtgggcctggaacacggcactg
gcttgggtttgtggtgatgtttgtgtttggaaaccttcagaaaaaactcctttgtgcggt
gttgcctgccaaaatataatagcacaagtcctaaaagaaaataatcttcctgaaggcatc
tcttgtttgatcaatggggattataaagttggtgagctaatgaccaatgacaacagaatt
ccattagtatcggcaacgggttccattcgtatgggaaaaatcgtggcacaggcagttgca
gcaagattgggaaaatccttgttagaactgggcggtaacaatgctatcatagttacgccc
gatgccgatatcaaaatgacagtaataggtgctgtctttggtgctgtcggaactgcagga
caacgttgcacctcaactcggcgattaattatacacgaatcaatctatgaccaagtaaaa
gattccataacagatgcttataagcaactaagaattggtaatcctttggacgaaaacaat
catgtagggcctttaatcgatgttgatgcagttaaaatgtataagacagctttggaaaat
gcaaaagctgagggcggaagtattttaattgaagggggtgtcttagatggtaatggttat
aaaagtggatgctatgtaaaacctgctattgttgaagctgacaattcatttaaaatagtt
caagaggaaacctttgcaccaattttatatctgttaaaatattcaggtggcgtagaaaat
gccattgcacagcaaaatggtgttgttcaagggctttcctcggcaattatgacgaatagt
ttacgtgaagccgaacattttttatcggccaaaggaagtgattgcggtattgcgaatgta
aacattggtacctctggcgctgaaataggaggagcatttggtggtgaaaaagaaacaggt
gggggacgtgagagtggctcggacgcatggaaaatctacatgagacggcagacaaatacg
attaattataccacagagttacctttggcacaaggcataaaatttgatttataa

DBGET integrated database retrieval system