KEGG   Sporosarcina sp. P37: SporoP37_00110Help
Entry
SporoP37_00110    CDS       T04826                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spop  Sporosarcina sp. P37
Brite
Enzymes [BR:spop01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SporoP37_00110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N bZIP_Maf
Motif
Other DBs
NCBI-ProteinID: ARK23244
LinkDB All DBs
Position
17765..18373
Genome map
AA seq 202 aa AA seqDB search
MAYTLPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNVNNALEGHDELLNMPVDELVAN
LDKVPEDKRTAVRNNGGGHSNHSLFWTILSPNGGGNPTGEVAEAIDKKFGSFDAFKEEFA
KAATTRFGSGWAWLVVNNGELEVTSTPNQDSPYMDGKTPLLGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVEKRYQDNK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttatacattaccagaactgccatacgcttatgacgcgttggagccacacatcgac
aaagaaacgatgaacatccatcacacgaaacaccacaacacgtatgtaactaacgtgaac
aatgcactagaaggtcacgatgagcttctgaacatgcctgttgacgagttggttgcaaac
ttggacaaagttccagaggacaagcgtacagcggtacgcaataacggtggcggacactct
aaccactcattattctggacgatcctatcgccaaacggcggcggcaacccgactggggaa
gtagctgaagcaatcgacaagaagttcggcagctttgacgctttcaaagaagagtttgct
aaagcagcaacaactcgctttggttcaggatgggcttggctcgttgtgaacaatggtgaa
ttggaagtaacttcaacacctaaccaggactcaccttatatggatggtaaaacaccatta
ctaggtttggacgtttgggagcacgcttactacctgaactaccaaaaccgtcgtcctgac
tacatttcagctttctggaacgtagtaaactgggatgaagttgaaaagcgttaccaagac
aataaataa

DBGET integrated database retrieval system