KEGG   Sporosarcina sp. P37: SporoP37_01680Help
Entry
SporoP37_01680    CDS       T04826                                 

Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00230  Purine metabolism
spop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SporoP37_01680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spop04147]
    SporoP37_01680
Enzymes [BR:spop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     SporoP37_01680
Exosome [BR:spop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SporoP37_01680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ARK23528
LinkDB All DBs
Position
complement(314074..314586)
Genome map
AA seq 170 aa AA seqDB search
MDLKKFVTTVDDYPKPGVSFKDITTIMDNGEAYKYATDQIVEYAKELDVDIIVGPEARGF
IIGCPVAYALQIGFAPVRKPGKLPRETISVEYDLEYGKDTLTIHKDAIKPGQRVLIVDDL
LATGGTVSATVELVEKLGGVVAGCAFLIELSYLNGRDKLTNQDIRALITY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtggacttaaaaaaatttgttacgacagtagacgattatccgaaaccgggtgtcagcttt
aaagacattacgacgattatggataacggggaagcatataagtatgcgacagatcaaatt
gtagagtatgcgaaagaactcgatgtggatatcatagtagggccggaagcacgcggtttt
attattggctgtcccgttgcatatgcacttcagatcggttttgcgccggttcgtaagccg
ggtaaattaccgcgcgaaacgatttcggtcgaatatgatcttgagtatggaaaagatacg
ctgacgatccacaaagatgcgattaaaccgggtcagcgtgtgctgatcgtggatgatctg
ttggcgactggcggtacggtcagcgcaaccgtcgaactcgtcgaaaaacttggcggcgta
gtggcaggctgcgcattcctgattgaactttcgtacctcaatgggcgcgacaagttaact
aaccaagacatccgggcattaattacgtactga

DBGET integrated database retrieval system