KEGG   Sporosarcina sp. P37: SporoP37_03945Help
Entry
SporoP37_03945    CDS       T04826                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00061  Fatty acid biosynthesis
spop00780  Biotin metabolism
spop01100  Metabolic pathways
spop01130  Biosynthesis of antibiotics
spop01212  Fatty acid metabolism
Module
spop_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SporoP37_03945
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SporoP37_03945
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SporoP37_03945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spop01004]
    SporoP37_03945
Enzymes [BR:spop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SporoP37_03945
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SporoP37_03945
Lipid biosynthesis proteins [BR:spop01004]
 Fatty acid synthase
  Component type
   SporoP37_03945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ARK23933
LinkDB All DBs
Position
754365..755144
Genome map
AA seq 259 aa AA seqDB search
MVDLLKLSGKNIVIMGVANERSIGWGVAKALFSVGANVIFTYRKDRSREKLEKALEKNEF
TAAQIVQCDVNSDESIEHAFKTIGEQVGVIHGVVHSIAFAHQQDLHNPFVETTREGYAFA
QDSSSYSLVAAAREARHYMTEGGAIVTMSYLGAERVLEGYNVMGVAKAALEASVRYLASE
LGEQNIRVNAISAGAVRTLSAKGVPSFNTILGQIEERAPLKRNVKPEEVSDMTIAMLSNL
SSGVTGEVIYVDAGYHIMG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttattaaaattatcagggaaaaatattgtaattatgggtgtcgcgaatgaa
cgcagcataggctggggcgtggcaaaagcattgttttcagtcggggcgaatgtcattttc
acttaccgtaaagaccgttcacgtgaaaagctagaaaaggcattggagaaaaatgaattt
accgcagcacaaattgtgcagtgtgatgtaaatagtgatgaaagcatcgaacacgctttc
aaaaccatcggagaacaggtcggtgtcatccatggtgtggttcactctatcgcattcgcg
catcagcaagatctgcataatccattcgttgaaactacacgtgagggctatgcattcgcg
caagattccagttcgtattcactggtggcggcagcacgtgaagcacgtcattatatgacg
gaaggcggcgcaatcgttacgatgagttatttaggagctgaacgtgttctcgaaggttat
aacgtaatgggtgtggcgaaggcagctcttgaagcgtctgtgcgctacctggcttctgag
cttggtgaacaaaatattcgtgtcaatgcaatctctgccggtgcggtccgtacattatcc
gcaaaaggtgttccttcctttaatacaattctcggccagattgaagaacgtgcaccattg
aaacgaaacgtaaaaccggaagaagtttcggatatgacgatagcgatgctcagtaattta
tcaagcggtgtgacgggtgaggtcatctatgtggatgccggctatcacattatggggtaa

DBGET integrated database retrieval system