KEGG   Sporosarcina sp. P37: SporoP37_07795Help
Entry
SporoP37_07795    CDS       T04826                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
spop  Sporosarcina sp. P37
Pathway
spop03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spop00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SporoP37_07795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spop03400]
    SporoP37_07795
Enzymes [BR:spop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SporoP37_07795
DNA repair and recombination proteins [BR:spop03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SporoP37_07795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ARK24573
LinkDB All DBs
Position
complement(1496304..1496966)
Genome map
AA seq 220 aa AA seqDB search
MFRIPDELARIAQERSEGFPVEGFVRGEGPESPSLLLIGEAPGEHEAIHGIPFIGRAGDE
LMKSLASIGLTREDVYMTSSFRSRPYKWGTKKERDGSLTERKYNRPPTQKEQLAHAPVLD
FEVKNLRPKLIVTLGNIGLQRLLGKHAKVTALHGQVITQPVQYLAALEDTQYSWTDHSYT
IVPTFHPASVFYRPSLRPELESDWQRIGEYLQGLTDNSFE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcatacctgatgaattggcgcgtattgcgcaagaacgcagcgaaggatttcca
gtggaaggctttgtgcgcggagaaggtcccgaatcaccatcgcttttattgatcggtgaa
gcacccggagaacacgaagcgatacacggcatcccgtttataggacgtgcgggtgatgag
ctgatgaaatcactggcatcgatcggtctgacgcgggaagatgtgtatatgacgagttca
ttccgcagcaggccttataaatgggggacgaagaaagaacgtgacggcagtttgactgaa
cgtaaatataaccggccgcctactcaaaaagagcagctggctcatgcgccggtacttgat
tttgaagtgaaaaatctgcgtccgaagctcatcgtgacactcggtaatatcggccttcag
cgattgctaggaaaacacgcgaaagtcacggcgctgcatggacaagtaatcacacagccc
gtccaatacttagcggcactggaagatacgcagtacagctggacagatcattcctacacc
atcgtgccgacatttcatccggcttccgttttttaccgtccatctctccgtccggaactg
gagagcgactggcagcggatcggtgaatatctccaaggactaacagataactcatttgaa
taa

DBGET integrated database retrieval system