KEGG   Sporosarcina sp. P37: SporoP37_08355Help
Entry
SporoP37_08355    CDS       T04826                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
spop  Sporosarcina sp. P37
Brite
KEGG Orthology (KO) [BR:spop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spop03012]
    SporoP37_08355
   03029 Mitochondrial biogenesis [BR:spop03029]
    SporoP37_08355
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spop04147]
    SporoP37_08355
Translation factors [BR:spop03012]
 Eukaryotic Type
  Elongation factors
   SporoP37_08355
 Prokaryotic Type
   SporoP37_08355
Mitochondrial biogenesis [BR:spop03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SporoP37_08355
Exosome [BR:spop04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SporoP37_08355
  Exosomal proteins of breast cancer cells
   SporoP37_08355
  Exosomal proteins of colorectal cancer cells
   SporoP37_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ARK24669
LinkDB All DBs
Position
complement(1587999..1589186)
Genome map
AA seq 395 aa AA seqDB search
MGKEKFDRSKEHANVGTIGHVDHGKTTLTAAIATVLSKAQGGEAKSYADVDNAPEEKERG
ITISTSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEIRELLSEYDFPGDDIPVIRGSALKALE
GEPEWEEKIIELMQAVDDYIPTPARDTEKPFMMPVEDVFSITGRGTVATGRVERGVVKVG
DVVDIIGLADEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIERGQVLAKPGTI
TPHTQFKSEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIQLPEGVEMVMPGDNVEM
TVELISPIAIEEGTKFSIREGGRTVGAGVVATITK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagaaaaattcgaccgctccaaggagcacgcaaacgtaggaacaattggtcac
gttgaccatggtaaaacaactttgactgctgctatcgcgacagttttgtctaaagctcaa
ggtggagaagcaaagtcatacgctgacgttgataacgcacctgaagaaaaagagcgtgga
attacaatcagtacttcacacgttgagtacgaaacagataagcgtcactacgcacacgtt
gactgcccaggtcacgctgactatgttaagaacatgatcactggtgctgcacaaatggac
ggcggaatcctagtagtatctgctgctgacggcccaatgccacaaacacgtgagcacatc
cttctttctcgtcaagtaggtgttccttacctagttgtattcatgaacaaatgtgacatg
gtagacgacgaagaactacttgaactagtagaaatggaaatccgtgaacttctttctgag
tatgacttccctggcgatgacattccagtaatccgcggatcagctcttaaagctcttgaa
ggagagccagagtgggaagaaaaaatcatcgaactaatgcaagctgtagatgactatatc
ccaacaccagctcgtgatactgaaaagccattcatgatgcctgttgaggacgtattctca
attacaggccgcggtacagtagcaactggccgtgttgagcgtggagtagttaaagtcgga
gatgttgttgacatcatcggtcttgctgacgaaccaaaatctactactgtaacaggtgta
gaaatgttccgtaagcttcttgattatgcagaagctggagacaacattggtgctcttctt
cgtggtgtagctcgtgaagatatcgagcgtggacaagttcttgctaagccgggaacaatc
acaccacacactcagttcaaatctgaagtttatgttctatcaaaagaagaaggcggacgt
cacactccattcttctcaaactaccgcccacagttctacttccgtacaactgacgtaact
ggcatcattcaacttcctgaaggcgtagaaatggttatgcctggagataacgttgaaatg
acagttgaacttatttctccgatcgcgattgaagaaggtactaaattctcaatccgtgaa
ggtggacgtacagttggagctggcgttgtagcaacaatcacaaaataa

DBGET integrated database retrieval system