KEGG   Sporosarcina sp. P37: SporoP37_10265Help
Entry
SporoP37_10265    CDS       T04826                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spop  Sporosarcina sp. P37
Brite
KEGG Orthology (KO) [BR:spop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SporoP37_10265
Enzymes [BR:spop01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SporoP37_10265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like DAO FAD_binding_3 FAD_oxidored Thi4 NAD_binding_8 AlaDh_PNT_C NAD_binding_7 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ARK26270
LinkDB All DBs
Position
complement(1984508..1985989)
Genome map
AA seq 493 aa AA seqDB search
MMENDVLLKVSTGSDHVSNEMNVLVNELETMSSHIKVEKTELERTPSFSVNRIGEDTGIT
FAGVPLGHEFTSLVLALLQVSGRDPKVDQKLIDQVKKLDGTYHFESYISLSCQNCPEVVQ
ALNIMSVLNPNITHTMIDGAAFKEEVESKKIMAVPTVYLNGEEFSGGRISLEEILAKMGS
APDASELENKEPFDVLVVGGGPAGASAAIYAARKGIRTGVVADRFGGQILDTATIENFIS
VTRTEGPKLAASLEEHVKEYDVDIMNLQRAKRLEKKDLIEIELENGAVLKSKSVILSTGA
RWRDIGVPGEAEFRNKGVAYCPHCDGPLFEGKDIAVVGGGNSGIEAAIDLAGIVKHVTVL
EFASELKADSVLQDRLHSLPNVTVLKNVQTKEITGTDSVNGITYIDRDTNEEHHIELAGV
FIQIGLVPNTDWLGDSVERNKFGEIVVDKRGATNVPGVFAAGDCSDSAHKQIIIAMGSGA
TSALSAFDYLVRN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaatgacgtgcttctgaaagtcagcacgggatctgaccatgtttcgaatgaa
atgaacgttttagtgaatgaattagaaacgatgtcatctcacattaaagtagagaaaacc
gagctggaaagaaccccaagtttcagtgtaaaccgtatcggagaagatactggcatcacg
tttgcaggcgtcccgcttggacatgaattcacttcattagttcttgcgttattacaagta
agcggacgtgatccaaaagtagatcagaagcttattgatcaagtaaaaaaacttgacggt
acttaccatttcgaatcgtatataagcttaagctgtcaaaactgtcctgaagtggtccaa
gcacttaacattatgagtgtcctaaacccgaacataactcatacgatgattgatggtgcg
gcatttaaagaggaagttgaaagcaaaaagatcatggctgtgccaacagtatatttaaat
ggggaagaattctcaggcggccgtatatcactggaagaaatccttgcgaaaatgggcagt
gcgccagacgcttcggaacttgaaaacaaggagccgtttgacgtgcttgttgtcggaggc
ggtcctgcaggtgcaagtgctgctatttatgcggcgcgcaaagggattcgcacgggcgtt
gtagcagatcgttttggcggtcaaattttggacacggctacgattgaaaactttattagt
gttactcgaactgaaggtccaaaacttgctgcaagccttgaagagcacgtgaaagagtac
gacgtagatatcatgaacttacagcgtgcaaaacgtttggaaaagaaagatcttattgaa
attgaactggaaaacggtgctgttttaaagagtaaatcggttatcctttccacaggtgcc
cgttggcgagacattggcgtccctggcgaagcagaatttagaaataaaggtgtcgcatac
tgcccgcactgtgatggcccattgtttgaaggcaaagacattgctgtcgttggcggcggc
aactctggcattgaggcagcaattgaccttgcaggtattgtaaagcatgtaacagttctt
gagtttgcttccgagctgaaagccgactctgttttacaagacagacttcacagccttcca
aacgttactgtattgaaaaatgttcaaacgaaagaaattactggtaccgatagtgtaaac
ggaattacgtacattgaccgtgacacaaatgaagagcaccatatcgaactggctggcgtt
tttattcaaattggtctcgtaccaaatacagactggctaggcgattcagttgaacgtaat
aaattcggcgagattgttgtcgataagcgcggtgcaacaaacgtgcctggcgtttttgct
gcgggagactgctccgatagcgcccataaacaaatcattattgcaatgggatcaggcgca
acttctgcgttaagtgcatttgattatctagttagaaattaa

DBGET integrated database retrieval system