KEGG   Sporosarcina sp. P37: SporoP37_11420Help
Entry
SporoP37_11420    CDS       T04826                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SporoP37_11420
Enzymes [BR:spop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SporoP37_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 PB1 DUF2100
Motif
Other DBs
NCBI-ProteinID: ARK25205
LinkDB All DBs
Position
2222716..2224191
Genome map
AA seq 491 aa AA seqDB search
MKLTNYIGGVWQKEAARYTAVLNPANGEELAQVPLSSDEEVRQAVAAAKKAQKKWALVPA
PKRADYLYEIGRLMKDRKEHLSQVLTKEMGKVIEEARGEVQEGIDMAFYMAGEGRRLFGE
TVPSELQDKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIVAGNTFVWKPATETPLMA
HEMSLIFEEAGLPHGVANIVYGSGSDVGTALIEHPDVRVISFTGSTETGRHVAELGGRHL
KKVSLEMGGKNAVIVMDDADLELAVEGILWSAFGTAGQRCTACSRVIVHEKVKEELQKRL
VESMKELTMGDGLDETVKVGPVINEKALKKIEKYIEIGKEEGAILAAGGNVLRDGKFADG
HYFEPTLFADVAWDSRLAQEEIFGPVVSLITVGSLDEAIEVNNSVAYGLSSSIFSQDVNK
VFRAQRDLDTGIVYINAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWKSIYVDYS
GKLQRAQIDTE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgactaactatatcggcggcgtctggcagaaggaagcggctcgctataccgcc
gtactcaacccggcgaacggagaagaactggcgcaagttccgctgtcttcagatgaagag
gtgcggcaggcggtggctgctgctaaaaaagcgcagaaaaaatgggcgctggttccggca
ccgaaacgtgcagattatctctatgaaatcggacggctgatgaaagacagaaaagaacac
ctctcgcaagtattgacgaaagaaatgggtaaagtaatagaagaggcgcgcggtgaagtg
caagagggaattgacatggcgttctatatggcaggagaaggccgcagactgttcggcgaa
acagttccgtccgagctgcaagataaatttgcgatgagcgtacgtgccccaatcggcgta
gtcgggctcatcaccccatggaatttcccgattgccatcgccacgtggaaatcgttcccg
gcaatcgtcgcgggcaatacgttcgtttggaaaccggcaacggaaacgccgctgatggcg
cacgaaatgtcattgatttttgaagaagcgggcttgccgcatggcgtagcgaacatcgtc
tatggctcaggaagtgatgttggtactgcgctgatcgaacatcccgacgtgcgcgttatt
tcctttacgggttcaaccgaaacgggccgtcatgtcgcggaattgggcgggcgtcatttg
aaaaaagtatcgctggaaatgggcggaaaaaacgcggtcatcgtaatggatgacgcggat
cttgagctggcggttgaagggattttgtggagcgcattcggtacggcaggacagcgctgt
acagcctgcagccgtgtcatcgtacatgaaaaggtaaaagaagagctgcagaaacgtctc
gtcgaaagcatgaaagaactgacgatgggcgacggactggatgaaacagtaaaagtcggt
ccggtgatcaatgaaaaagcattgaagaaaatagaaaagtatattgaaatcggcaaagaa
gaaggggcgattctagctgcgggcggaaatgtcttgcgtgacggtaaatttgcggacggc
cattacttcgagccgactcttttcgcagacgttgcatgggacagccgcctggcgcaggaa
gaaatatttggacctgtcgtttcattgattacagtcggcagtctggatgaagcaatcgaa
gtgaataacagcgtcgcatatggcctgtcaagttccattttctcgcaggatgtcaataaa
gtattccgtgcgcagcgcgatctggatacaggaatcgtctatatcaatgcgggaacgaca
ggtgcagaaattcatttgccgtttggcggaacgaagggtacggggaatggacaccgtgac
tcgggtgtcgccgcgctggacgtctttacggaatggaagagcatttacgtcgattacagc
gggaaattgcagcgcgcgcagatcgatacggagtga

DBGET integrated database retrieval system