KEGG   Sporosarcina sp. P33: SporoP33_03250Help
Entry
SporoP33_03250    CDS       T04790                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
spor  Sporosarcina sp. P33
Pathway
spor00061  Fatty acid biosynthesis
spor00780  Biotin metabolism
spor01100  Metabolic pathways
spor01130  Biosynthesis of antibiotics
spor01212  Fatty acid metabolism
Module
spor_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SporoP33_03250
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SporoP33_03250
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SporoP33_03250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spor01004]
    SporoP33_03250
Enzymes [BR:spor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SporoP33_03250
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SporoP33_03250
Lipid biosynthesis proteins [BR:spor01004]
 Fatty acid synthase
  Component type
   SporoP33_03250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ARD47366
LinkDB All DBs
Position
683901..684680
Genome map
AA seq 259 aa AA seqDB search
MVDLLKLSGKNIVIMGVANERSIGWGVAKALFSVGANVIFTYRKDRSREKLEKALEKNEF
TAAQIVQCDVNSDESIEHAFKTIGEQVGVIHGVVHSIAFAHQQDLHNPFVETTREGYAFA
QDSSSYSLVAAAREARHYMTEGGAIVTMSYLGAERVLEGYNVMGVAKAALEASVRYLASE
LGEQNIRVNAISAGAVRTLSAKGVPSFNTILGQIEERAPLKRNVKPEEVSDMTIAMLSNL
SSGVTGEVIYVDAGYHIMG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttattaaaattatcagggaaaaatattgtaattatgggtgtcgcgaatgaa
cgcagcataggctggggcgtggcaaaagcattgttttcagtcggggcgaatgtcattttc
acctaccgtaaagaccgttcacgtgaaaagctggaaaaggcattggagaaaaatgaattt
accgcagcacaaattgtgcagtgtgatgtaaatagtgatgaaagcatcgaacacgctttc
aaaaccatcggagaacaggtcggtgtcatccatggtgtggttcactctatcgcattcgcg
catcagcaagatctgcataatccattcgttgaaactacacgtgagggctatgcattcgcg
caagattccagttcgtattcactggtggcggcagcacgtgaagcacgtcattatatgacg
gaaggcggcgcaatcgttacgatgagttatttaggagctgaacgtgttctcgaaggttat
aacgtaatgggtgtggcgaaggcagctcttgaagcgtctgtgcgctacctggcttctgag
cttggtgaacaaaatattcgtgtcaatgcaatctctgccggtgcggtccgtacattatcc
gcaaaaggtgttccttcctttaatacaattctcggccagattgaagaacgtgcaccattg
aaacgaaatgtaaaaccggaggaagtttcggatatgacgatagcgatgctcagtaattta
tcaagcggtgtgacgggcgaggtcatctatgtggatgccggctatcacattatggggtaa

DBGET integrated database retrieval system