KEGG   Sporosarcina sp. P33: SporoP33_08090Help
Entry
SporoP33_08090    CDS       T04790                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
spor  Sporosarcina sp. P33
Pathway
spor00010  Glycolysis / Gluconeogenesis
spor00620  Pyruvate metabolism
spor01100  Metabolic pathways
spor01110  Biosynthesis of secondary metabolites
spor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SporoP33_08090
   00620 Pyruvate metabolism
    SporoP33_08090
Enzymes [BR:spor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SporoP33_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ARD48188
LinkDB All DBs
Position
complement(1612721..1614262)
Genome map
AA seq 513 aa AA seqDB search
MVQASESQVYANPNTEGSKVQFKERYENFIGGKWTAPVKGQYFDNSTPVTGKVFTQVARS
TEEDIELALDAAHAAKDAWGKTSVTERSNILLKIADRMEENLEMLAVAETWDNGKAVRET
LNADLPLAIDHFRYFASAIRAQEGGVSQIDNDTVAYHFHEPLGVVGQIIPWNFPILMAVW
KLAPALAAGNCIVLKPAEQTPASILVLVELIEDLLPAGVLNVVNGFGLEAGKPLASNPRI
NKVAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVMAEDDAFLDKAVEGFVMF
ALNQGEVCTCPSRALIQESIYDKFMERALERVKAIKTGNPLDPTVMMGAQASTEQLEKIL
SYLDIGKQEGAECLTGGEQNKLEGDLADGYYVKPTVFKGHNKMRIFQEEIFGPVVAVTTF
KDKEEALEIANDTLYGLGSGVWTRDMNTAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKA
SGIGRENHLQMLAHYQQTKNMLVSYDESKQGFF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagcttcagaaagtcaggtttatgcaaacccaaatacagaaggttcaaaggtt
cagttcaaagagcgctatgaaaactttatcggcggtaagtggacggcgcctgtaaaaggc
cagtattttgataattcaacgccagttacaggtaaggtatttacccaggttgctagatcg
acagaagaagatattgaactggctttggatgcagcccacgcagcaaaagatgcatgggga
aagacatcagtcactgaacgttcgaatattttgctgaagatcgcggatcgcatggaagag
aatcttgaaatgcttgccgtagctgaaacatgggataacggaaaagctgtacgtgaaacg
ttaaatgcggatcttccgcttgcaatagatcattttagatactttgcttcggctatccgt
gcgcaagaaggcggagtcagtcaaatcgataatgacactgtagcctaccatttccatgag
ccgctgggagtcgtggggcagattatcccttggaacttcccgattctgatggcagtatgg
aagcttgctccggcgctggcggcaggcaactgtatcgtattaaaaccggctgaacaaacg
cctgcatctattttggtgctggtggagttaattgaagacttactgccggcaggtgttctg
aatgttgtcaacggttttggactagaagcaggaaagccgctggcgtccaatccgcgcatc
aataaagttgccttcacaggggagacaacaacaggccgtctgatcatgcaatacgcttct
caaaacttaattccggttacattggagctcggcgggaaatccccgaatattttctttgaa
gacgtgatggcggaagatgatgcattcctcgataaagcagttgaaggttttgttatgttt
gccttgaaccagggggaagtctgtacatgtccatcgcgagcactgattcaggaatccatt
tacgataagttcatggaacgtgcacttgagcgtgttaaagcaatcaagacaggaaatcca
ctggatccaacggtcatgatgggtgcgcaggcgtctactgaacaattggagaaaattctt
tcctacttagatatcggaaaacaagaaggcgcagaatgtctgacgggcggagagcagaac
aaactggaaggcgatctcgcagacggttactacgtgaagccgacggtatttaaaggacat
aataaaatgcgtatcttccaggaggagatctttggtcctgtggtggcagttacgacattc
aaagataaagaagaagcgctggaaatcgcgaacgacacattatatggactgggttcaggt
gtatggacgcgtgatatgaatacggcgtaccgcttcgggcgcggcatccaggcagggcgc
gtatggacaaactgctatcatgcatatcctgcgcatgctgcattcggaggctacaaagct
tcaggcatcggccgtgaaaaccacttgcagatgcttgcacattaccagcagacgaaaaac
atgctggtaagttatgatgaaagcaaacaaggattcttttaa

DBGET integrated database retrieval system