KEGG   Sporosarcina sp. P33: SporoP33_13055Help
Entry
SporoP33_13055    CDS       T04790                                 

Definition
(GenBank) hypothetical protein
  KO
K02250  competence protein ComK
Organism
spor  Sporosarcina sp. P33
Pathway
spor02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:spor00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SporoP33_13055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spor03000]
    SporoP33_13055
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spor02044]
    SporoP33_13055
Transcription factors [BR:spor03000]
 Prokaryotic type
  Other transcription factors
   Others
    SporoP33_13055
Secretion system [BR:spor02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   SporoP33_13055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK DUF4520
Motif
Other DBs
NCBI-ProteinID: ARD49072
LinkDB All DBs
Position
2692842..2693396
Genome map
AA seq 184 aa AA seqDB search
MKNRTESVITPGTSLVYPYYNETGKLCAVLLKDGEFVRVDKSPTDVIDVSMQYFGSSLQG
GIAGARSMLGRISMSPVMINEKLDMYWFPSKSPSSDDCVWFSLSHILTYMPIAKDRTKII
FRDGTIFTLDCSYDSFEWKHQRTCMYKNGLEAQINFMADNVKKSYKTYLIRRNRKRGNYE
VSDE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacagaacggaatccgtgatcacaccggggaccagcctggtttatccgtactac
aatgaaacaggaaaattatgtgccgtgttgctgaaagacggagaatttgtgcgtgtcgat
aaaagtccgacagatgtaatcgatgtcagtatgcaatatttcggatccagtttacagggc
ggaattgccggagcaagatcgatgctcggcagaatcagcatgtcgcctgtcatgatcaat
gaaaagctggacatgtactggttccccagcaagtcgccgtcaagcgatgattgtgtatgg
ttttcgctcagtcatattttgacgtatatgccgattgccaaggaccggacgaaaatcatt
ttccgggacggcacgatttttactttggattgcagttacgattcatttgagtggaagcac
cagcgcacatgcatgtacaaaaatggtctggaggcgcagattaatttcatggcagacaat
gtgaagaaaagttataaaacgtacttgattcggagaaatcgtaaacggggaaattacgaa
gtgtctgatgaatag

DBGET integrated database retrieval system