KEGG   Sporosarcina sp. P33: SporoP33_13565Help
Entry
SporoP33_13565    CDS       T04790                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spor  Sporosarcina sp. P33
Pathway
spor00010  Glycolysis / Gluconeogenesis
spor00020  Citrate cycle (TCA cycle)
spor00620  Pyruvate metabolism
spor01100  Metabolic pathways
spor01110  Biosynthesis of secondary metabolites
spor01120  Microbial metabolism in diverse environments
spor01130  Biosynthesis of antibiotics
spor01200  Carbon metabolism
Module
spor_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SporoP33_13565
   00020 Citrate cycle (TCA cycle)
    SporoP33_13565
   00620 Pyruvate metabolism
    SporoP33_13565
Enzymes [BR:spor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SporoP33_13565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ARD49161
LinkDB All DBs
Position
2806247..2807635
Genome map
AA seq 462 aa AA seqDB search
MTYEFRLPDIGEGIHEGEIVKWFVKPGDEIQEDDTLLEVQNDKSVVEIPSPVSGTVEEIY
VTEGTVAVVGDKLIRFDAPDHGIPDHDDHEEESADSSSEEASAEKSHEQVGEALGSQGSA
KPEQAPAEQPAAEQKTEQAPKASRDDADETRRVIAMPSVRKYAREQDVAIAQVSGSGKNG
RVLKEDVDLFKSGGQQQTAAETADAQQNAETVMDTQAVSEKQTPVLEGEFPETREKMTPM
RKAISKAMSNSKHTAAHVTLLDEVDVTALVAHRKEFKAIAAERDIKLTYLPYVVKALVAT
LREFPQLNTSLDDATEELIQKHYYNIGIAADTDRGLMVPVVKNADRKSVFAISSEVNELA
GKARDGKLQASEMRGASCTITNIGSAGGQWFTPIINHPEVAILGVGRISEKPVVKNGEIV
AAPMLALSLVFDHRVIDGVTGQLALNYLKELLGNPSLLLMEA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgacttatgaatttcgattgccagacattggtgaaggtatacacgaaggggaaatcgtc
aaatggttcgtgaagccgggcgatgaaatccaggaagatgatacattgctggaagtgcaa
aatgataaatctgtagtagaaatcccgtcacctgtatcgggaacggtagaagaaatatat
gtgacagaaggtacagtggcggttgtgggagataagctgatccgcttcgacgcaccggat
cacgggattccggatcatgacgatcatgaagaagagagtgcagattcttcatccgaagaa
gcaagtgcagaaaaatctcatgagcaagtaggggaagcactgggcagccaaggttcagcg
aaacctgaacaggctccagcagagcagccggcagcagaacagaaaacggagcaggcgcct
aaagcctcgcgtgatgacgcagatgaaactcgccgtgtcattgcgatgccttctgtccgc
aagtatgcacgtgaacaagacgttgcgattgcgcaagtgtcaggcagcggcaaaaacggc
cgtgtgttaaaagaagatgtggatttattcaaatcaggaggacagcagcagactgcagca
gaaacagctgatgcgcagcaaaatgctgaaactgtaatggatacgcaggcagtatctgaa
aagcagacacctgtgcttgaaggagaattccctgaaacacgcgagaagatgactccgatg
cgaaaagcaatttcaaaagctatgtcgaattccaaacatacagcggctcacgttacattg
ctggatgaagtagatgtaacagcgctcgtcgcgcaccgtaaagaatttaaagcgatcgct
gcagaaagagatattaaactgacgtatcttccgtatgtagtgaaagcgctagttgcgaca
ttgcgtgaattcccgcaattgaacacatcgctggatgatgcaacagaagagttaatccaa
aaacattattataatatcggaattgccgcagatacagaccgcggacttatggttccagtt
gttaaaaatgcagaccgtaaatcagtattcgctatttccagcgaagtaaatgaactggcc
ggaaaagctcgcgatggaaaacttcaggcatctgaaatgagaggcgcgtcgtgcacaatc
acaaatatcggctcagcaggcggacagtggttcacgccaattattaaccatcctgaagta
gctattttaggagtcggaagaatttctgaaaaacctgtggtgaaaaatggtgaaattgta
gcggcacctatgttagcattatccttagtgttcgatcaccgagtaattgatggcgtaacg
gggcaattagcgttaaactatcttaaggaattactagggaacccatcacttttattaatg
gaggcgtaa

DBGET integrated database retrieval system