KEGG   Sporosarcina sp. PTS2304: DV702_01895Help
Entry
DV702_01895       CDS       T05572                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spos  Sporosarcina sp. PTS2304
Pathway
spos00010  Glycolysis / Gluconeogenesis
spos00020  Citrate cycle (TCA cycle)
spos00620  Pyruvate metabolism
spos01100  Metabolic pathways
spos01110  Biosynthesis of secondary metabolites
spos01120  Microbial metabolism in diverse environments
spos01130  Biosynthesis of antibiotics
spos01200  Carbon metabolism
Module
spos_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DV702_01895
   00020 Citrate cycle (TCA cycle)
    DV702_01895
   00620 Pyruvate metabolism
    DV702_01895
Enzymes [BR:spos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DV702_01895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N FancD2
Motif
Other DBs
NCBI-ProteinID: AXH98571
UniProt: A0A345NU63
LinkDB All DBs
Position
443752..445122
Genome map
AA seq 456 aa AA seqDB search
MTYEFRLPDIGEGIHEGEIVKWFVKPGDEIQEDDTLLEVQNDKAVVEIPSPVSGTIEEIY
VQEGTVAVVGDKLVRFDAPDHDIPDHDDDHTEDTASENASVEKSHEQVGEALGSTEAKKP
AEGQREQTQPEQTQSQQPKAEATDDHRRVIAMPSVRKYAREQDVVIAEVTGSGKNGRILK
EDVDSFKSGGQPQASAESTEIEQETQETPETATAKQQPVLEGEFPETREKLSPMRKAISK
AMSNSKHTAAHVTLLDEVDVTALVAHRKEFKEVAAKKDVKLTYLPYVVKALVATLREFPE
LNTSLDDSTEELIHKHYYNIGIAADTDRGLMVPVVKNADRKSMFAISAEVNELAEKARSG
KLQASEMKGGSCTITNIGSAGGQWFTPIINHPEVAILGVGRISEKPVVKNSEIVVAPMLA
LSLVFDHRVIDGVTGQLALNYLKELLGNPSLLLMEA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgacctatgaatttcgtttaccagacattggagaaggtatacacgaaggagaaatcgtt
aagtggttcgtaaaaccaggcgatgaaatccaagaagatgatacattattagaagtacaa
aatgataaagcagtagtagaaattccatcaccggtttcaggtactatagaggaaatttac
gttcaagaaggtacagtagcagttgttggagataaactagtacgctttgatgcaccagat
cacgacattcccgatcatgatgatgatcacacagaagatacagcttctgaaaatgccagt
gttgaaaaatctcatgaacaagttggagaagcgttaggcagtactgaagcaaagaaacca
gcagaaggtcagcgtgaacaaacgcaacccgagcaaacacagtcacaacaacctaaagct
gaggcaacagatgaccatcgccgcgtaattgctatgccgtctgttcgtaagtatgcaaga
gaacaagatgtggtaattgcagaagtaaccggtagtgggaaaaacggccgcatattaaaa
gaagatgtagattcctttaaatctggaggtcagccacaagcgagcgctgagtccacagaa
atagaacaagaaactcaggaaacacctgaaactgcaactgcgaaacagcaaccggtattg
gaaggtgaattcccagaaacacgcgagaaattatcaccaatgcgtaaagctatttcaaaa
gcgatgtcgaattccaagcatacagcggcacatgtgacgttactggatgaagtagacgtt
accgcgctcgttgctcatcgtaaagaatttaaagaagtagcagcgaaaaaagatgtgaaa
cttacgtacttaccatatgtagtgaaagcactagtagcgacattgcgtgaattccctgaa
ttaaatacatcattggatgactcgacagaagagttgatccacaagcattattacaatatt
ggaattgcagcggatacagaccgcggcttaatggttccagttgttaaaaatgcggatcgc
aaatcaatgtttgctatttctgcagaggtaaatgaacttgctgaaaaagcacgttctggt
aaattgcaagcttctgagatgaaaggcggatcatgtacaattacaaatatcggttccgcg
ggtggacaatggtttacgccaattatcaatcatcctgaagtcgctattttaggtgttgga
agaatttctgaaaaacctgtagtaaaaaatagtgaaattgtagtggcacctatgttagca
ttatctttagtgttcgatcaccgagtaattgatggcgtaacgggacaattagcgttaaac
tatcttaaggaattactagggaacccatcacttttattaatggaggcgtaa

DBGET integrated database retrieval system