KEGG   Sporosarcina sp. PTS2304: DV702_02365Help
Entry
DV702_02365       CDS       T05572                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spos  Sporosarcina sp. PTS2304
Brite
KEGG Orthology (KO) [BR:spos00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spos01001]
    DV702_02365 (pknB)
Enzymes [BR:spos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DV702_02365 (pknB)
Protein kinases [BR:spos01001]
 Serine/threonine kinases: Other
  Bacterial family
   DV702_02365 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like Pkinase_fungal APH RIO1 Kdo FTA2 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AXH98659
UniProt: A0A345NUF1
LinkDB All DBs
Position
540649..542661
Genome map
AA seq 670 aa AA seqDB search
MIGKRIGKRYEIIRVIGDGGMSRVYLAHDMILDRDVAIKVLHYDFANEEELKKRFRREAL
SATSLTHPHIVNIFDVGQEDEHHYLVMEYIAGKTLKEYIHTHGALTPEHAVSIMQQLVSA
ISHAHHNGIIHRDIKPQNVLMNSEDEVKITDFGIAMALDSTVHTKTNSVIGTVHYLSPEQ
ARGGMATKRSDIYSLGIVFYELLTGQLPFSAETAVAIALKHLQEETPSVRKKFPEIPQSV
ENVILKATAKDANYRYTTTDEMYEDLLTVFSPERANEDKFALPFDDDRTVAIPAVKDVPV
VEDIEDTVNIAPAAVEVTSPPKKKKKWPFVLAGSVVLLAMIAIVLFIMLKPKEIIVPTVV
GVEELAAIEILEKEGFVIDERIEETSDDYLAGQVTRTVPDAGKKRKEGDGVKLFISTGKD
KMKLNDYTGRNFEATERFLKGYGFKPIEAVEVYADEPKGTIIDQQPEADTMVIPEETDLI
FTVSKGKELQSLEDLRGMTKKQLEDYADSTGFTIHIVGEEESDTVEKGRVISQKPAKGTK
MDKGGRVDVVVSKGEATKPVKLLVKMLTIPYEVVEEQTPDDEFEPDPEVGNEAESETETA
TELERVPQKIQIYIQDRNHTMNDAYEEFEITEDTTRKITIELEDGERGGYKILRDQKVIE
EDQFNYKDLD
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaaaagaataggcaaacgttatgaaattattcgtgtgattggtgacggtggg
atgtctagagtgtatttagcgcatgacatgatactagatcgtgacgttgcaattaaagta
ctccactatgattttgccaatgaagaagaactgaaaaagcgatttcggcgtgaagcgctt
tctgcgaccagcttaacccatccgcatattgtgaatatttttgatgtcggacaagaagat
gagcatcattatttagtgatggaatacatagccggtaagacattgaaagaatatattcat
acacatggcgcgctaactccggaacatgcggtttccatcatgcagcaattagtatctgct
atatctcatgctcatcataacggcattattcatcgagatattaagccacagaatgtgttg
atgaatagtgaagatgaagtgaagattacagatttcggtatagctatggcacttgattct
acagtgcatacgaaaacgaattcagttatcggtactgttcattatttatcacctgagcaa
gcacgcggtggaatggcgactaaacgctcggatatatattcgcttggaattgtgttttat
gaattgcttactggtcaattaccgttttctgctgaaactgccgtcgcgattgctttaaaa
catttgcaggaagaaacaccgtccgttcgtaagaagtttcccgaaattcctcaaagtgtt
gaaaacgtcattttgaaagctacagcaaaagatgcaaattatcgctatacaacgacagat
gaaatgtacgaagatttgttaactgtattttcacccgaacgagcaaatgaggataaattc
gctttaccatttgatgatgatcgaacagttgcgattccggctgttaaagatgtgccagta
gtcgaagatatagaagacacagtgaatatagcacctgccgcagtagaggtgacttctccg
ccaaagaaaaagaagaaatggccattcgttttagctggcagcgtagtgttgttggctatg
atagcaattgtattgttcataatgttgaaaccaaaagaaattattgttcctactgtagtt
ggtgttgaagaattggcagcaatcgaaattcttgaaaaagaaggattcgtgattgatgaa
agaatagaagaaacgtcagatgattatcttgccggacaagtgacaagaacggttccggat
gcgggtaagaagcgcaaagaaggggacggcgttaagttatttattagtacgggaaaagat
aaaatgaagttaaatgactatactggccgcaatttcgaggcgacagagcgttttttaaaa
gggtatggattcaaaccgattgaagctgtagaagtatatgcagatgaaccaaaaggcacg
attattgatcaacaaccagaagcagatactatggtcattcctgaagaaactgatttgatt
ttcacagtgagtaaaggaaaagaattgcagtcattggaagatttacgcggtatgacaaaa
aagcaattggaagactatgctgatagtacaggttttacgatccatattgtaggcgaggaa
gagtcggatacagtggaaaaaggacgtgtcatttcccaaaagcctgctaaagggacgaag
atggataaaggtggtcgggtggatgtagtggtctctaaaggtgaagcgacaaaacctgtg
aaacttctagtgaagatgttgacgattccctatgaagtagtagaggaacaaacaccagac
gatgagtttgaacccgatccggaagttggtaatgaagctgaatcagagacagaaacagcc
actgaactagaacgcgtgccacaaaaaatacaaatttatatccaagatcgaaaccatacg
atgaatgacgcgtatgaagagtttgaaattacagaagatactacacgtaaaatcactatc
gagcttgaagatggcgaacgtggcggatataagattttacgtgatcagaaagttattgaa
gaagatcagttcaactataaagatttagattaa

DBGET integrated database retrieval system