KEGG   Sporosarcina sp. PTS2304: DV702_04210Help
Entry
DV702_04210       CDS       T05572                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spos  Sporosarcina sp. PTS2304
Brite
Enzymes [BR:spos01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DV702_04210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AXH99004
UniProt: A0A345NVE6
LinkDB All DBs
Position
907874..908482
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYITNVNNALEGHDELLNMPVDELIAN
LDKVPEDKRGAVRNNGGGHSNHSLFWTILSPNGGGKPTGEVAEAIDKKFGSFDAFKEEFA
KAATTRFGSGWAWLSVNNGEVEVTSTPNQDSPFMDGNTPLLGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVEKRYQAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgaattaccagaactaccatacgcttatgacgcgttggagccacacatcgac
aaagaaacgatgaacatccatcacacgaaacaccacaacacgtacattacaaacgtgaac
aacgcacttgaaggtcatgatgaacttcttaacatgccagttgacgagctaatcgcaaac
ttggacaaagttccagaggacaagcgcggagctgttcgtaataacggtggtggacactca
aaccactcattattctggacaatcctttcaccaaacggtggcggcaaaccaactggagaa
gttgcagaagcaatcgacaaaaaattcggtagctttgacgcgttcaaagaagaatttgct
aaagcagcaactacacgctttggttcaggttgggcttggctatcagtaaacaacggagaa
gttgaagtaacatcaactcctaaccaagactctccattcatggatggcaacacaccattg
cttgggcttgacgtttgggagcacgcatactacttaaactaccaaaaccgtcgtccggac
tacatttcagcattctggaacgtagtaaactgggacgaagttgaaaaacgctaccaagca
gctaaataa

DBGET integrated database retrieval system