KEGG   Sporosarcina sp. PTS2304: DV702_12415Help
Entry
DV702_12415       CDS       T05572                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
spos  Sporosarcina sp. PTS2304
Pathway
spos00010  Glycolysis / Gluconeogenesis
spos00620  Pyruvate metabolism
spos01100  Metabolic pathways
spos01110  Biosynthesis of secondary metabolites
spos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DV702_12415
   00620 Pyruvate metabolism
    DV702_12415
Enzymes [BR:spos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DV702_12415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AXI00447
UniProt: A0A345NZI8
LinkDB All DBs
Position
complement(2579730..2581271)
Genome map
AA seq 513 aa AA seqDB search
MVQTSEHQVYANPNTEGAKVHFKERYENFIGGKWTAPVNGQYFDNPTPVTGKVFTQVARS
TAEDIELALDAAHAAKDAWGKTSVTERSNILLKIADRLEENLEMLAIAETWENGKAVRET
LNADLPLAIDHFRYFASAIRAQEGGVSQLDNDTVAYHFHEPLGVVGQIIPWNFPILMAVW
KLAPALAAGNCVVLKPAEQTPASILVLVELIEDLLPAGVLNVVNGFGLEAGKPLASNPRI
SKIAFTGETTTGRMIMQYASQNLIPVTLELGGKSPNIFFEDVMAEDDAFLDKAIEGFVMF
ALNQGEVCTCPSRALIQESIYDKFMERALERVKAIKTGNPLDPTVMMGAQASTEQLEKIL
SYLDIGKQEGAECLVGGEQNMLDGDLKDGYYVKPTVFKGNNKMRIFQEEIFGPVVAVTTF
KDKEEALEIANDTLYGLGSGVWTRDMNTAYRFGRGIQAGRVWTNCYHAYPAHSAFGGYKA
SGIGRENHLQMLAHYQQTKNMLVSYNESKQGFF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaacttcagaacatcaggtgtatgcgaatccgaatacagaaggtgcaaaggtt
cattttaaagaacgctacgaaaatttcatcggtggcaaatggacagcgcctgtgaatggt
caatattttgataacccaacacctgtgacaggaaaagtattcacccaagtggcacgttct
acagcagaggatatcgaactcgctcttgacgcagcacacgcagcaaaagatgcatggggc
aagacatctgtaacagaacgatcgaatattctattgaaaattgcagatcgtttagaggaa
aacttggaaatgcttgcgattgccgaaacgtgggaaaatggtaaagcagttcgtgaaaca
ttgaatgcagacttgccactggcgattgatcacttccgctattttgcttccgctatccgt
gcgcaagaaggcggcgtcagccaactggataacgatacggtagcctatcatttccacgaa
ccgttaggggtagtcggtcaaatcattccttggaacttccctatactaatggcagtttgg
aaactcgcaccggcgctcgcagcaggaaactgtgtggtattgaaaccggcagaacagact
ccagcttctattctagtattggtggagttaattgaagatctgcttccggcgggcgtgctt
aatgttgtcaacggctttggtctagaagctggaaagccactagcatccaatccgcgtatt
agtaaaattgcctttacgggagaaacgacaacagggcgcatgattatgcaatacgcatca
caaaatttaattcctgtgacattagaacttggcgggaaatctccgaatattttctttgaa
gatgttatggcggaagacgacgcatttttggataaagccattgaaggatttgtgatgttt
gctttaaaccaaggggaagtatgtacatgtccatcgcgtgcattaattcaagaatcgatt
tacgataaatttatggaacgtgcactggaacgcgtaaaagcgatcaaaacaggcaacccg
ctagatccaacagttatgatgggcgcccaagcatctacagagcaattggaaaagatcctt
tcttatttagacatcggtaagcaagaaggtgcggaatgtctggtaggcggggaacaaaat
atgctcgatggtgatttaaaggacggttattacgtcaagccgactgtatttaaaggaaat
aataaaatgcgtattttccaggaagagatttttgggcctgtcgtagcggtaacaacattt
aaagacaaagaagaagcgttggaaatcgcaaacgacacactttatggattgggctctggt
gtttggacacgtgatatgaatacggcttatcgttttggacgcggtattcaagcaggtcgt
gtgtggacaaactgttatcatgcatatcctgcacactctgcattcggtggctataaagca
tccggtatcggaagagagaatcacttacagatgttggcgcattaccagcaaacaaaaaat
atgttagtgagctataatgaaagcaagcaaggattcttttaa

DBGET integrated database retrieval system