Sulfitobacter pontiacus: G6548_08120 Help Entry G6548_08120       CDS       T06732                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spot  Sulfitobacter pontiacus Pathway spot01100   Metabolic pathways spot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G6548_08120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G6548_08120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QLL42493 LinkDB All DBs Position 1677682..1677915 Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ENIQTFGDAVKFIKEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagaccgcgtaaagaagatcgttgtagagcacctgggtgttgaagaa gacaaagttgttgagaacgcatcgttcatcgacgatcttggcgcagacagcctcgacact gttgagctggttatggcgttcgaagaagagttcggcatcgagatccccgatgacgcagcc gagaacatccagaccttcggcgacgcggtcaagttcatcaaagaagcgtcctaa

DBGET integrated database retrieval system