KEGG   Streptococcus pneumoniae P1031 (serotype 1): SPP_0466Help
Entry
SPP_0466          CDS       T00874                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spp  Streptococcus pneumoniae P1031 (serotype 1)
Pathway
spp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPP_0466
Enzymes [BR:spp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SPP_0466
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SPP_0466
    1.1.1.-  
     SPP_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACO21379
LinkDB All DBs
Position
complement(413668..414711)
Genome map
AA seq 347 aa AA seqDB search
MATMKAARWHAAKDVRIQEIEVPEVLPHQVKVAVKFTGICGTDLHEFLDGPIFIPTDEHV
YSGQKAPVTLGHEFSGEIIEVGSDVTRVKVGDRVAVEPILAKNNLVGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSSLKAGDTAVVFGLGP
IGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGETAVEAIHRLTNGGVDV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEFAIQEKTLKGIIAYRHIFPK
VLELMEQGYFSAEKLVTKKIKLENIVEEGFIELTQDKSQIKILVEPE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatgaaggcagctcgctggcatgcagcgaaagatgttcgtattcaagaaata
gaagttcctgaagtacttccgcaccaagtaaaagttgcagttaagttcacaggaatttgt
ggtactgacctccatgaatttttagatggacctatctttatcccaacagatgagcacgtc
tattctggtcaaaaagcaccggtaacactgggacatgaattttctggtgaaatcatagaa
gtcggaagcgatgttacccgtgttaaagttggtgatcgtgttgctgtggaaccaattcta
gctaaaaataacttagttggtgattataatttggatccaaaccttaattttgtcggtttg
gctgcagacggtggatttgccaaatattgtgttttagacggtgacttagtacatgtcatt
ccagatagcttgagctatgaacaagctgctcttactgaacccgctgctgttgcagtctat
gctgttcgtcaatcttctttgaaggctggcgatacagctgttgtctttggtttaggcccg
attggtctattaattgtagaagctcttcgtgcagctggtgcttctaagatttatgctgtt
gaactatcacctgaacgtcaagcaaaagctgaagagttaggagctatcgttgtccgtccg
gaagaaggtgaaacagctgttgaagctattcatcgtttaacaaacggtggtgtagatgtt
tcttatgaagtaacgggtgtgccagtagttttaggacaagccttagctgccgtacataaa
gcaggtgagtgcatggtggtctctatctgggaacgagaagcaaatattaatccgaatgaa
tttgcaatccaagaaaagacactaaaaggaatcatcgcttatcgtcatatcttccctaaa
gtattagaattgatggaacaaggctacttctctgctgaaaaattagttactaagaaaatt
aaattggaaaatatcgtcgaagaaggctttatcgaattaactcaagataagtcacaaatt
aaaattttggtagaaccagaataa

DBGET integrated database retrieval system