KEGG   Streptococcus pneumoniae P1031: SPP_1074Help
Entry
SPP_1074          CDS       T00874                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spp  Streptococcus pneumoniae P1031
Pathway
spp00620  Pyruvate metabolism
spp00680  Methane metabolism
spp01100  Metabolic pathways
spp01120  Microbial metabolism in diverse environments
spp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPP_1074 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SPP_1074 (ppc)
Enzymes [BR:spp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SPP_1074 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Lysine_decarbox
Motif
Other DBs
NCBI-ProteinID: ACO22115
LinkDB All DBs
Position
981596..984292
Genome map
AA seq 898 aa AA seqDB search
MSLQKLENYSNKSVVQEEVLILTELLEDITKNMLAPETFEKIIQLKELSTQEDYQGLNRL
VTSLSNDEMVYISRYFSILPLLINISEDVDLAYEINHQNNIDQDYLGKLSTTIKLVAEKE
NAVEILEHLNVVPVLTAHPTQVQRKSMLDLTNHIHSLLRKYRDVKLGLINKDKWYNDLRR
YIEIIMQTDMIREKKLKVTNEITNAMEYYNSSFLKAVPHLTTEYKRLAQAHGLNLKQAKP
ITMGMWIGGDRDGNPFVTAKTLKQSALTQCEVIMNYYDKKIYQLYREFSLSTSIVNVSKQ
VREMARQSKDNSIYREKELYRRALFDIQSKIQATKTYLIEDEEVGTRYETANDFYKDLIA
IRDSLLENKGESLISGDFVELLQAVEIFGFYLASIDMRQDSSVYEACVAELLKSAGIHSR
YSELSEEEKCDLLLKELEEDPRILSATHAEKSELLAKELAIFKTARVLKDKLGDDVIRQT
IISHATNLSDMLELAILLKEVGLVDTERARVQIVPLFETIEDLDHSEETMRKYLSLSLAK
KWIDSRNNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKVTFFHGRGGTV
GRGGGPTYEAITSQPLKSIKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMITQ
KKSDTNTPNRYEAIMDQVVDRSYDIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFINKNPENIAILRDMYQNWPFF
QSLLSNVDMVLSKSNMNIAFEYAKLCEDEQVKAIYEIILNEWQVTKNVILAIEGHDELLA
DNPYLKASLDYRMPYFNILNYIQLELIKRQRRGELSSDQERLIHITINGIATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcaaaaattagaaaattatagtaataaaagtgttgtgcaagaagaagtcttg
attctaacagaattactggaagatattactaaaaatatgcttgccccagagacctttgaa
aaaataatacagttgaaagaattatcaacgcaggaagattatcaaggtctaaaccgtcta
gtgactagcttatcaaatgatgaaatggtctatatttcacgctatttctctatcttgcct
cttttgattaatatttcagaggatgtggatttagcttatgaaatcaatcatcaaaataat
attgatcaggactatttaggtaaattatctacaacgattaaattggtagcagaaaaggaa
aatgccgttgagatcctagaacacttgaatgttgtccctgttttgacagcccatccaaca
caagtgcaacgcaaaagtatgttggatttaacaaatcatattcatagtcttttgcgtaaa
taccgtgatgttaagttggggttgatcaataaagataaatggtacaatgatttgcgtcgt
tacatcgaaattatcatgcagacagacatgattcgtgagaaaaaattaaaagtgactaac
gaaatcacgaatgctatggaatattataacagctcctttttgaaagctgtacctcatttg
acgacggagtataagcgcttagcgcaagcgcatggtctgaatttaaaacaggctaaacca
atcaccatgggtatgtggataggtggtgaccgtgatggaaatccatttgttacagcaaag
accttgaagcagtctgcactcactcagtgtgaagtcatcatgaactactatgataaaaag
atttaccaactttatcgtgaattttctctttcaactagcattgtcaacgtcagcaagcaa
gtcagagaaatggctcgtcaatccaaggataactcgatttaccgcgaaaaagagctttac
cgtcgtgccttgtttgatattcaatcaaaaattcaggcaactaaaacctatctgattgag
gatgaagaagttgggactcgttatgaaaccgccaatgatttctacaaggatttgattgcc
attcgagattctctactagaaaataagggcgagtccttgatttcaggtgattttgtggaa
ttattgcaggcagtagagatatttggtttttacttagcatcaattgatatgcgacaagac
tctagcgtctatgaagcctgtgtggcagaactcttgaaatcagcaggaattcattctcgt
tatagcgagttgagcgaagaagaaaagtgtgaccttctcttgaaagaattagaagaagat
ccccgaattctttctgcgactcacgcagaaaaatcagaattattagcaaaagaattagct
atttttaagacggctcgtgttttgaaagataagttgggagatgatgtcatccgtcagacc
atcatttcacatgcaaccaacctttctgatatgctagaattagctattctgttaaaagaa
gtaggactggtggatacggaaagggcgcgtgttcagattgttcccctttttgaaacaatt
gaagacttggatcattcagaggaaacaatgagaaaatatctttctcttagccttgccaaa
aaatggattgactcacgaaataactaccaagaaatcatgcttggctactctgacagtaat
aaagatggcggttacttgtcatcatgttggaccctctacaaggctcaacaacaattgact
gctattggagatgaatttggcgttaaggttaccttcttccatggtcgtggtggtactgtc
ggtcgtggtggtgggccaacctatgaagccattacatctcaaccgctcaagtctatcaag
gatcgtatccgtttgacggagcagggtgaagtaattgggaataaatacggtaacaaagac
gccgcttactataaccttgaaatgctagtatcggcagctattaaccgtatgattactcag
aagaagagcgataccaataccccaaatcgttatgaagccattatggatcaagtagtggac
cgtagttacgatatctaccgtgatttggtctttggtaatgagcatttctatgattatttc
ttcgagtcaagtccaatcaaggctatttcaagttttaatattggttctcgtccagccgct
cgtaagactattactgaaatcggtggtttgcgtgccatcccttgggtattctcatggtca
cagagtcgtgttatgttccctggatggtacggggttggttcaagcttcaaggaatttatc
aataaaaatccagagaatattgctatcttacgagatatgtaccaaaattggcctttcttc
caatcgcttctttcaaatgttgatatggttttgtcaaaatcaaatatgaatattgctttt
gaatatgctaaactttgtgaagacgagcaagttaaggccatctatgagattattttaaat
gaatggcaagttactaagaacgttatcttggctattgaaggacatgacgaactcttagct
gacaatccatatctaaaagctagtctggattaccgtatgccttactttaatattctcaac
tatattcagttagagttgattaaacgccaacgtcgtggagaattgtccagtgatcaagaa
cgattgattcatatcaccatcaacggaattgcgacaggattgcgtaattcaggttga

DBGET integrated database retrieval system