KEGG   Streptococcus pneumoniae P1031 (serotype 1): SPP_1401Help
Entry
SPP_1401          CDS       T00874                                 

Definition
(GenBank) alpha-amylase (1,4-alpha-D-glucanglucanohydrolase)
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
spp  Streptococcus pneumoniae P1031 (serotype 1)
Pathway
spp00500  Starch and sucrose metabolism
spp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPP_1401
Enzymes [BR:spp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SPP_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACO20564
LinkDB All DBs
Position
1308988..1310442
Genome map
AA seq 484 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWTRLAEDAPHLAHLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFNQKGTVRTKYGFKEDYLQAIQALKAQGIQPMADVVLNHKAAADHMEAFQVIEVD
PVDRTVELGEPFTINGWTSFTFYGRQDTYNDFHWHWYHFTGTDYDAKRRKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMRNFIRDMKEKYGDDFYVFGEFWNPDKEANLDYLEKTEEHFDLVDVRLHQNLFEASQ
AGANYDLRGIFTDSLVELKPDKSVTFVDNHDTQRGQALESTVEEWFKPAAYALILLRQDG
LPCVFYGDYYGISGQYAQQDFKEILDRLLAIRKDLAYGEQNDYFDHANCIGWVRSGAENQ
SPIAVLISNDQENSKSMFVGQEWTNQTFVDLLGNHQGQVTIDEEGYGQFPVSARSVSVWA
VNTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaacgctcatgcaatactttgaatggtatctgccccacgacggtcagcac
tggacgcgtctggctgaagatgctccacacctagctcatctggggattagccacgtctgg
atgccaccagcttttaaggcaaccaatgaaaaagatgtcggctatggtgtctatgactta
tttgacctaggagagtttaaccaaaaagggactgtccgcactaagtatggtttcaaagaa
gactatcttcaagccattcaagccctaaaagcacagggaattcaacctatggccgatgtg
gttctcaatcacaaggctgcagccgatcacatggaagcctttcaggttatcgaagtggat
cctgtagaccgtacggttgaacttggagaacccttcaccatcaatggctggactagcttt
accttctatggtcgccaagatacctacaatgacttccactggcattggtaccacttcacc
ggtacagactacgatgcaaaacgccgtaagtctgggatttatctcatccaaggggacaac
aagggctgggctaacgaggaattggtcgataacgaaaacggaaactacgactacctcatg
tatgccgacctagactttaaacatcctgaagtcatccaaaacatctatgactgggctgat
tggttcatggaaacgactggtgtagctggtttccgtttggatgccgttaagcatattgac
tctttctttatgcgcaacttcatccgcgatatgaaggaaaaatacggtgacgatttctat
gtttttggtgaattttggaacccagacaaggaagccaatctggactatctcgaaaaaacg
gaagaacactttgaccttgtcgatgttcgtctccaccagaatctctttgaagccagtcaa
gctggcgcaaactatgaccttcgtggcattttcacagatagcctggttgaactcaagcct
gacaagtctgtgacttttgtcgacaaccacgatacccaacgaggacaagcccttgagtct
accgttgaagaatggttcaagccagcagcctatgccctcattttgttacgccaagacggc
cttccatgtgtcttttacggagactactatgggatttcaggccagtatgctcaacaagat
ttcaaagaaatccttgaccgcctcctagccatccgaaaagatttggcctatggagaacaa
aatgactactttgaccatgctaactgtatcggttgggtacgttcaggtgctgaaaatcaa
tccccaatcgcagtcttgatttcaaatgaccaagaaaacagcaagtcaatgtttgtcggt
caagaatggactaatcaaacctttgtagatttacttggtaaccaccaaggtcaagttaca
attgatgaggaaggttatggacaattccctgtctcagctagatccgtaagtgtctgggca
gtcaataccatctaa

DBGET integrated database retrieval system