KEGG   Streptococcus pneumoniae P1031 (serotype 1): SPP_1689Help
Entry
SPP_1689          CDS       T00874                                 

Definition
(GenBank) D-alanine--D-alanine ligase (D-alanylalanine synthetase)(D-Ala-D-Ala ligase)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spp  Streptococcus pneumoniae P1031 (serotype 1)
Pathway
spp00473  D-Alanine metabolism
spp00550  Peptidoglycan biosynthesis
spp01100  Metabolic pathways
spp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPP_1689
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPP_1689
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SPP_1689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spp01011]
    SPP_1689
Enzymes [BR:spp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPP_1689
Peptidoglycan biosynthesis and degradation proteins [BR:spp01011]
 Precursor biosynthesis
  Amino acid ligase
   SPP_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 PAXNEB
Motif
Other DBs
NCBI-ProteinID: ACO20433
UniProt: C1CM10
LinkDB All DBs
Position
complement(1563550..1564593)
Genome map
AA seq 347 aa AA seqDB search
MKQTIILLYGGRSAEREVSVLSAESVMRAVNYDRFTVKTFFISQSGDFIKTQEFSHAPGQ
EDRLMTNETIDWDKKVAPSAIYEEGAVVFPVLHGPMGEDGSVQGFLEVLKMPYVGCNILS
SSLAMDKITTKRVLESAGIAQVPYVAIVEGDDVTAKIAEVEEKLAYPVFAKPSNMGSSVG
ISKSENQEELRQALKLAFRYDSRVLVEQGVNAREIEVGLLGNYDVKSTLPGEVVKDVAFY
DYDAKYIDNKITMDIPAKISDDVVAVMRQNAETAFRAIGGLGLSRCDFFYTDKGEIFLNE
LNTMPGFTQWSMYPLLWDNMGISYPELIERLVDLAKESFDKREAHLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacgattattcttttatatggtggacggagtgcggaacgcgaagtctctgtc
ctttcagctgagagtgtcatgcgtgcggtcaattacgaccgtttcacagtcaagactttc
tttatcagtcagtcaggtgactttatcaaaacacaggaatttagtcatgctccggggcaa
gaagaccgtctcatgaccaatgaaaccattgattgggataagaaagttgcaccaagtgct
atctacgaagaaggtgcagtggtctttccagtccttcacgggccaatgggagaagatggc
tctgttcaaggattcttggaagttttgaaaatgccttacgttggttgcaacattttgtca
tcaagtcttgccatggataaaatcacgactaagcgtgttctggaatctgctggtattgcc
caagttccttatgtggctatcgttgaaggcgatgatgtgactgctaaaatcgctgaagtg
gaagaaaaattggcttatccagtcttcgctaagccgtcaaacatggggtctagtgtcggt
atttctaagtctgaaaaccaagaagaactccgtcaagccttaaaacttgccttccgatat
gacagccgtgtcttggttgagcaaggagtgaatgcccgtgaaattgaggttggcctcttg
ggtaactacgatgtcaagagcacgctacctggagaagttgtcaaggacgttgccttttat
gactacgatgccaagtatattgataacaagattactatggatattcctgccaaaatcagt
gatgatgtggtggctgtcatgcgtcaaaatgcagaaacagccttccgtgccattggtggc
cttggtctatctcgttgcgatttcttctatacagataagggagagatttttctcaacgag
ctcaataccatgccaggtttcacccagtggtctatgtacccactactttgggacaatatg
gggatcagctacccagaactaatcgagcgtttggttgaccttgccaaggaaagttttgac
aagcgcgaagcgcatttgatataa

DBGET integrated database retrieval system