KEGG   Streptococcus pneumoniae P1031 (serotype 1): SPP_2017Help
Entry
SPP_2017          CDS       T00874                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spp  Streptococcus pneumoniae P1031 (serotype 1)
Pathway
spp00220  Arginine biosynthesis
spp00250  Alanine, aspartate and glutamate metabolism
spp00290  Valine, leucine and isoleucine biosynthesis
spp01100  Metabolic pathways
spp01110  Biosynthesis of secondary metabolites
spp01130  Biosynthesis of antibiotics
spp01210  2-Oxocarboxylic acid metabolism
spp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPP_2017
   00290 Valine, leucine and isoleucine biosynthesis
    SPP_2017
   00220 Arginine biosynthesis
    SPP_2017
Enzymes [BR:spp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SPP_2017
    2.6.1.66  valine---pyruvate transaminase
     SPP_2017
Amino acid related enzymes [BR:spp01007]
 Aminotransferase (transaminase)
  Class I
   SPP_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: ACO20591
LinkDB All DBs
Position
complement(1853875..1855089)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKELLLGIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtcct
gtattggaagaagccatgcggatgcgagcgaatggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggctttacagcgccagacgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaaggctattctgactccaaagggattttctcagcccgtaaggcc
atcatgcagtattgccagctgaagaaattcccaaacgtagatattgatgatatttacctt
ggaaatggtgtcagtgagttgattgtcatgtccatgcaggggcttttggacaatggggat
gaggtcttagtgccaatgccagactatcctctatggacggcggctgtcagcctagctgga
ggaaatgccgttcactatatctgtgatgaagctgtggaatggtacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaattgtccttatcaatccaaataaccca
actggagccctttatcctaaggaactcttgctggggattattgagattgcccgtcaaaac
gatttgattatctttgcggatgaaatctatgaccgcatggtaatggacggacatgtgcat
acgcctgtggcgagcttggcaccagatgtcttctgtgtcagcatgaatggtctgtcaaaa
tcccaccgcatagcaggtttccgtgtgggttggatggtcttgtctggccctaagactcat
gttaagggctatatcgaagggctcaatatgctgtccaatatgcgcctttgctctaacgtt
ttggcccaacaagtcgtacaaacttccttggggggtcaccaatcagtcgatgaattgctt
cttcctggtggacgaatctacgagcaaagaaatttcatctataatgccattcaagatatt
ccaggtttgtctgccgttaaacccaaggcggggctctatatcttcccaaaaatcgaccgc
aatatgtaccgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgaggctttaactggcaggaaccagaccacttccgtatcgtt
taccttcctcgtgttgatgagttagcccaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system