KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_01041Help
Entry
SPAB_01041        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00550  Peptidoglycan biosynthesis
spq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPAB_01041
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spq01002]
    SPAB_01041
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spq01011]
    SPAB_01041
Enzymes [BR:spq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SPAB_01041
Peptidases and inhibitors [BR:spq01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SPAB_01041
Peptidoglycan biosynthesis and degradation proteins [BR:spq01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SPAB_01041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ABX66462
LinkDB All DBs
Position
951179..952345
Genome map
AA seq 388 aa AA seqDB search
MKRRLFIAASLFAMHLSPALAADAVSFAPQPPAIDAGAWVLMDYTTGQVLTAGNEHQQRN
PASLTKLMTGYVVDRAIDSHRISPDDIVTVGRDAWAKDNPVFVGSSLMFLKEGDRVSVRD
LSRGLIVDSGNDACVALADYIAGGQPQFVAMMNSYVKKLNLQDTHFETVHGLDAPGQHSS
AYDLAVLSRAIIHGEPEFYHMYSEKSLTWNGITQQNRNGLLWDKTMHIDGLKTGHTSGAG
FNLIASAVDGQRRLIAVVMGAKSSKGREEQARKLLQWGLQNFATVQILHSGKKVGSERIW
YGDKEKIALGTEQDFWMALPKAEIPHIKAKYVLDRKELEAPIAAHQQVGEIELYDRDKLI
AQWPLVTLESVGKGGMFSRLSDYFQHKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgccgtttgtttattgccgcttctttattcgcgatgcacctttctcctgcgctt
gcggccgatgccgtaagttttgctccccaaccgccagccattgatgcaggcgcctgggtg
ttgatggattacactacgggacaggttcttaccgccggtaatgaacaccagcaacgtaat
cccgccagccttaccaagctaatgacgggctacgtcgtcgatcgcgccatcgatagtcat
cgtatcagccctgacgatatcgtcaccgttgggcgcgacgcctgggcgaaggataatccg
gtgtttgtcggctcctcgttgatgtttttaaaagaaggggatcgcgtgtcggtacgcgat
ttaagccgtggcttaattgtggattccggtaacgatgcctgtgtggcgctggcggattat
atcgcgggcgggcagccgcagtttgtggcgatgatgaacagctatgtgaaaaaactcaat
ttacaggatacccattttgaaaccgtccacggtctggatgcgccgggacaacatagctcc
gcgtatgatctggccgtactctcccgggcgattattcacggcgaacctgaattttatcac
atgtacagcgagaaaagcctgacctggaacggcatcacgcagcagaaccgcaacggcttg
ttatgggataagaccatgcatatcgatgggcttaaaaccggacacacatcgggggcggga
tttaatcttatcgcatcggcggtggacgggcagcgccgacttatcgccgtcgtgatggga
gcgaaaagttcgaaaggtcgtgaggaacaggcgcgaaaactgttgcagtggggcctgcaa
aactttgcgacggtgcagattttgcacagcggtaaaaaagtgggcagcgagcgaatctgg
tatggagacaaagaaaagattgcgctgggtacggagcaggatttctggatggcgctgccc
aaagcggaaattccgcatatcaaagcaaaatatgtgctggatagaaaagagctggaggcg
ccaatcgccgctcatcaacaggtaggtgaaatagagctttacgatcgggataaactgatc
gctcagtggccgctggtcactctggaatcggtgggtaaaggcggtatgttctctcgtctg
agcgactattttcagcataaagcgtaa

DBGET integrated database retrieval system