KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_02750Help
Entry
SPAB_02750        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00010  Glycolysis / Gluconeogenesis
spq00260  Glycine, serine and threonine metabolism
spq00680  Methane metabolism
spq01100  Metabolic pathways
spq01110  Biosynthesis of secondary metabolites
spq01120  Microbial metabolism in diverse environments
spq01130  Biosynthesis of antibiotics
spq01200  Carbon metabolism
spq01230  Biosynthesis of amino acids
Module
spq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spq_M00002  Glycolysis, core module involving three-carbon compounds
spq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:spq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAB_02750
  09102 Energy metabolism
   00680 Methane metabolism
    SPAB_02750
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAB_02750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spq04131]
    SPAB_02750
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spq04147]
    SPAB_02750
Enzymes [BR:spq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPAB_02750
Membrane trafficking [BR:spq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPAB_02750
Exosome [BR:spq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPAB_02750
  Exosomal proteins of melanoma cells
   SPAB_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABX68128
UniProt: A9MTL3
LinkDB All DBs
Position
2287091..2287843
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system