KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_03085Help
Entry
SPAB_03085        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K04079  molecular chaperone HtpG
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Brite
KEGG Orthology (KO) [BR:spq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spq01009]
    SPAB_03085
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spq03110]
    SPAB_03085
   04131 Membrane trafficking [BR:spq04131]
    SPAB_03085
   03051 Proteasome [BR:spq03051]
    SPAB_03085
   03029 Mitochondrial biogenesis [BR:spq03029]
    SPAB_03085
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spq04147]
    SPAB_03085
Protein phosphatases and associated proteins [BR:spq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SPAB_03085
Chaperones and folding catalysts [BR:spq03110]
 Heat shock proteins
  HSP90
   SPAB_03085
Membrane trafficking [BR:spq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    SPAB_03085
Proteasome [BR:spq03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    SPAB_03085
Mitochondrial biogenesis [BR:spq03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    SPAB_03085
Exosome [BR:spq04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPAB_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c HP0268 PE Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: ABX68447
UniProt: A9MW88
LinkDB All DBs
Position
complement(2572606..2574480)
Genome map
AA seq 624 aa AA seqDB search
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGD
GELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGTIAKSGTKSFLESMGSDQAKDSQLI
GQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEGEYTVADITKNDRGTEITLHL
REGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSE
IKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTSLLYIPSQAPWDLWNRDHKHGLKLY
VQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNVSREILQDSTVTRNLRSALTKRVLQML
EKLAKDDAEKYQTFWKQFGLVLKEGPAEDHANQEAIAKLLRFASTHTDSSAQTVSLEDYV
SRMKEGQEKIYYITADSYAAAKNSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKAF
QSVAKADESIEKLADEVDENAKEAEKALEPFVERVKTLLGDRVKEVRLTHRLTDTPAIVT
TDADEMSTQMAKLFAAAGQSVPEVKYIFELNPDHVLVKRTADTEDEAQFKEWVELLLDQA
LFAERGTLEDPNQFIRRMNQLLVS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacaagaaacgcgtggttttcagtcagaagttaaacagcttctgcacctgatg
atccattctctttattccaataaagaaatcttcctgcgtgaactcatctctaacgcctca
gatgcggcggacaagctgcgtttccgcgctctgtcaaacccggacctgtatgaaggagat
ggcgagctgcgtgtgcgcgtctctttcgataaagataagcgtacgttgaccattgccgat
aacggcgtggggatgaatcgtgatgaggtgattgaccacttaggcaccattgccaagtcc
ggcaccaaatctttcctcgaatcaatggggtccgatcaggcgaaagatagccagctcatt
ggtcagtttggcgtaggcttctactccgcgtttattgtggccgataaagtgaccgtacgt
actcgtgcggcaggcgacaagccggaaaatggcgtgttctgggaatcggcaggcgaaggc
gaatacaccgttgccgatatcaccaaaaatgaccgtggtacggaaatcaccttacacctg
cgtgaaggcgaagatgaattcctcgatgactggcgcgtacgctcgattatcagcaaatat
tccgatcacatcgcattgccggtagagattgaaaaacgggaagaaaaagacggcgaaacc
gtgatttcctgggagaaaatcaacaaggcccaggcgttgtggacccgtaacaagtcggaa
attaaagacgacgagtacaacgagttttacaagcacatcgcgcatgatttcaccgatccg
ctgacctggagccacaaccgcgtggaaggtaagcaggagtacaccagcctgctgtatatc
ccgtcgcaggcgccgtgggatctgtggaaccgcgatcacaaacatggtctgaagctgtac
gtacagcgcgtgttcattatggacgatgccgagcagttcatgccgaattatctgcgtttc
gtgcgcggcctgattgattctaacgacctgccgttgaacgtctcccgtgaaatcctgcag
gacagcacggtaacgcgtaatctgcgtagcgctctgaccaaacgcgttctgcaaatgttg
gaaaaactggcgaaagacgacgcggaaaaataccaaaccttctggaaacagttcggtctg
gtgctgaaagaaggcccggcggaagatcacgccaaccaggaagcgatcgctaaactgttg
cgctttgcctccacccataccgactcttccgcccagaccgtgtcgctggaagattacgtc
tcccggatgaaagaagggcaggaaaaaatctactacatcaccgcagacagctatgcggcg
gcgaaaaacagcccgcacctggagctgctgcgtaagaaaggcatcgaagtgctgctgctc
tccgatcgcatcgatgagtggatgatgaactacctgaccgagtttgacggtaaagcattc
cagtcggtcgctaaagccgatgagtccatcgaaaaactggcggatgaagtcgacgaaaac
gcgaaagaagcggaaaaggcgcttgagccgttcgtggagcgtgtcaaaaccctgctgggc
gatcgcgtgaaagaggtgcgtctgacgcaccgtttaaccgacacgccggcgattgtcacc
accgatgcggatgaaatgagcacccagatggcgaaactgttcgccgcggccggtcagtcc
gtgccggaagtgaaatacatctttgagctcaatccggatcatgtgctggttaaacgcact
gccgataccgaggatgaagcgcagtttaaagagtgggtcgagctgctgctggatcaggcg
ctgttcgctgaacgcggtacgctggaagatccgaaccagtttatccgccgtatgaaccag
ttgctggtatcctga

DBGET integrated database retrieval system