KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04071
Entry
SPAB_04071        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00052  Galactose metabolism
spq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPAB_04071
Enzymes [BR:spq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SPAB_04071
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 MTS ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 Methyltransf_11 3HCDH_N PrmA Shikimate_DH UDPG_MGDP_dh_N Met_10 Pyr_redox_2 Sacchrp_dh_NADP Methyltransf_24 CoA_binding ELFV_dehydrog Pyr_redox FAD_binding_2 Fer4_4
Other DBs
NCBI-ProteinID: ABX69398
UniProt: A0A6C6Z6A2
LinkDB
Position
3390559..3391602
AA seq 347 aa
MKSVVIHAEGDVRVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQLVLETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLAPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgcgcgttgaagaacgtcccttacca
caactgcaagccgaggacgatgtgttggtcaaggtcgttagctcagggctttgcgggtcg
gatatcccgcgtattttcgcgcagggcgcccattattatcctattacgttaggtcatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcccggcgatgcc
gtcgcttgtgtcccgcttcttccctgctttcactgtccgcaatgcgaacgcggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgcagcgaaggcggtaatgcggaatat
gtggtggtcaaacgggccaatcttttccgcttgccttctgatatgccgattgaagatggc
gcgtttatcgaaccgattaccgtgggcttacacgcctttcatctggcgcagggctgcgag
gggaaaaacgtaattatcgtcggggccgggacaattggcctgctggccttacagtgcgcg
cgggaactgggcgcgcgaagcgtaacggcgattgatatcaatccgcagaaactggaactg
gcgaaagcgctcggcgcaacgcatacctgtaatagccgggaaatgaccgccgacgacatc
cagaccgcgttgtccgacattcagtttgatcaactggttctcgaaacggcaggaactccc
cagaccgtctcgctggctatcgatatcgccgggccgcgcgcgcaactggcgctggtgggg
acgttacatcacgatctcaccctgacaacgcgtacattcgggttaattttgcgtaaagag
ctcacgctcctcggcagttggatgaactactccgcgccatggccaggagaggaatgggaa
accgcagcgcgcctgttggctgaaaaacgtcttcaactggcccctctcattgcccatcgc
ggcgatgcggaaagctttgcagaagcagtcaaagcgcttaatggcgcgcccatgcagggc
aaaattttacttcaactttcctga

DBGET integrated database retrieval system