KEGG   Salmonella enterica subsp. enterica serovar Paratyphi B: SPAB_04381Help
Entry
SPAB_04381        CDS       T00628                                 

Definition
(GenBank) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
spq  Salmonella enterica subsp. enterica serovar Paratyphi B
Pathway
spq00564  Glycerophospholipid metabolism
spq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPAB_04381
Enzymes [BR:spq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SPAB_04381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 3HCDH_N Pyr_redox_2 FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ABX69697
LinkDB All DBs
Position
3639925..3641433
Genome map
AA seq 502 aa AA seqDB search
MQTKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYVWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAAYVEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccaaagatctgatcgtgataggcgggggcattaacggtgcaggcatcgcggct
gatgccgccggacgcggtttgtccgtactcatgctggaagcgcaggatttggcctgcgcg
acctcttccgccagttcgaaacttatccacggcggcttacgctaccttgagcactacgag
ttccgtctggtcagcgaagcgctggcagaacgtgaagtgctgttgaaaatggcgccgcac
atcgccttcccgatgcgttttcgtctgccgcaccgcccgcatttacgtccggcctggatg
atccgtatcggtctgtttatgtacgatcacctcggcaaacgtaccagtttacccggttcc
accggtgtgcggtttggcgcagattcggtgctcaaaccggaaatcgtgcgcggattcgaa
tattccgactgctgggtagacgatgcgcgtctggtgctggctaacgcacagatggtggtg
cgtaaaggcggcgaagtccttacccgtactcgcgcaaccgccgctcgtcgggaaaatggc
ctgtggattgtcgaagcggaagatatcgacaccggtaaaaaatatgtctggcaggcgcgc
ggactggttaacgccaccggaccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccatatggcatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtccat
aatcagaagcaggcgtatattctgcaaaacgaagataagcgtatcgtctttgtcattccg
tggatggaagagttttcgatcattggcacgaccgatgtcgaatataaaggcgatccgaaa
gcggtaaaaattgaagagagcgaaattaattacctgttgaaggtttataacgcgcacttc
cagaaacaactggggcgcgatgacatcgtctggacgtactccggcgtccgtccgctgtgc
gatgatgagtccgactcaccgcaggcgatcactcgcgattatacccttgatattcatgat
gaaaacggcaaagcgccgctgctttccgtgtttggcggtaagctcacgacctaccgtaag
ctggctgaacacgcgatggaaaaactggcgtcttattatccaggcatcgggccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcg
aagctgcgtcgtcgttatccgttcctgacggaatcgctggcgcgccactattcgcgcact
tacggcagcaacacggagtggattctcggcgaagccacgtcgctgcttgatttaggcgaa
gatttcggtcatgagttttacgaggcggaactcaagtacctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgtcgcaccaaagaaggcatgtggctgaccgccgaa
cagcagtcccgcatcacccagtggctggcggcgtatgttgagaaacaccaactttcactg
gcgtcgtaa

DBGET integrated database retrieval system